(data stored in ACNUC7421 zone)

EMBL: CP001022.PE160

CP001022.PE160       Location/Qualifiers
FT   CDS_pept        179458..179928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0161"
FT                   /product="protein of unknown function DUF606"
FT                   /note="PFAM: protein of unknown function DUF606; KEGG:
FT                   bpu:BPUM_1773 hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59648"
FT                   /db_xref="GOA:B1YHB6"
FT                   /db_xref="InterPro:IPR006750"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHB6"
FT                   /protein_id="ACB59648.1"
FT                   /translation="MTLGIVLALFGGMMVCIQNTFNAKVKEQVGAWATTTLVLGLGFLA
FT                   SLTIGLLVEGGGLFSTSGMQPWFWFSGIIGVGVVLCVTQGVQQLGPSYAISIVMVSQIL
FT                   FALLWDTLGWFGLDQVAFTWTKAVGVVLIGGGVLLFQLGGKLTERRMLRKGA"
     atgacacttg gaatagttct ggccttattc ggcgggatga tggtctgtat tcaaaatacg        60
     tttaatgcca aggtcaagga acaggtcggg gcatgggcga caacgacgct tgtcctcgga       120
     ctcggattcc tggcgtcgct gacaatcgga ctgcttgttg aaggtggcgg tcttttttcg       180
     acgagtggga tgcaaccgtg gttttggttc agcggcatca tcggagtcgg cgtcgttttg       240
     tgcgtaacgc aaggggtgca acagctcgga ccaagttacg caatctcgat cgtcatggtc       300
     tcgcaaatcc tgtttgcctt gctgtgggat acactcggtt ggttcggact cgatcaagtc       360
     gcgttcacct ggacgaaagc tgtcggcgtc gtcctgattg gcggcggtgt tttattgttc       420
     caactcggcg gcaaattgac cgaacgacgg atgttacgaa aaggagcctg a                471
//

If you have problems or comments...

PBIL Back to PBIL home page