(data stored in ACNUC7421 zone)

EMBL: CP001022.PE161

CP001022.PE161       Location/Qualifiers
FT   CDS_pept        179932..180645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0162"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   1"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 1; PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: bld:BLi00219 YfnB"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59649"
FT                   /db_xref="GOA:B1YHB7"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR011951"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHB7"
FT                   /protein_id="ACB59649.1"
FT                   /translation="MNYTTLLFDIDHTLLDFDATERAALRQLFEDEQLEWTEEREARYR
FT                   TINRSLWQALERGEITRQEVITSRFVTFFAEQGRTVDGSRMDTRYRAYLSQGTELIAGA
FT                   IELLDSLKEKYQLYVVTNGVAATQRARLKGSGLAPYFDGIFVSEETGYQKPMPAFFDYV
FT                   FDRIPNVRRDQTIIIGDSLTADIQGGILAGIATCWFNPTHAAAPAELMPTYTINQLNQL
FT                   VTLLGTKEVVWTTSK"
     atgaactaca cgacattgtt atttgatatc gatcatacat tacttgattt tgatgcgacg        60
     gaacgcgcgg ccttgcggca actgtttgaa gacgagcagc tcgaatggac agaagagcgg       120
     gaagcccgtt accggacaat caaccgctcc ttgtggcagg cacttgaacg gggcgagata       180
     acacggcagg aagtgatcac atcacggttc gtgacgtttt ttgccgagca gggccggacg       240
     gtcgacggca gtcgaatgga tacgcgttac cgcgcgtact tgagtcaagg gacggaattg       300
     attgcagggg caatcgagtt gctcgactca ctcaaagaga agtatcagct gtatgtcgtg       360
     acgaacggtg tcgcagcaac gcaacgggct cggctcaaag gatccggttt ggctccttat       420
     tttgacggaa tttttgtctc ggaagaaacc ggctatcaaa aaccgatgcc agcctttttt       480
     gattacgtgt ttgaccgaat cccgaacgtg agacgtgacc agacgataat tatcggcgac       540
     tcgttgacgg cagatattca gggcggcatc ttggcaggca ttgcgacatg ctggtttaat       600
     cctactcatg ccgcggcgcc ggcggaactg atgccgacct atacgatcaa tcagcttaat       660
     cagcttgtga cgctgcttgg gacgaaagag gtagtttgga caacctcgaa ataa             714
//

If you have problems or comments...

PBIL Back to PBIL home page