(data stored in ACNUC7421 zone)

EMBL: CP001022.PE163

CP001022.PE163       Location/Qualifiers
FT   CDS_pept        181349..181894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0164"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; RNA polymerase sigma-70 factor, TIGR02954 family;
FT                   PFAM: sigma-70 region 2 domain protein; sigma-70 region 4
FT                   domain protein; Sigma-70 region 4 type 2; KEGG:
FT                   bld:BLi04171 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59651"
FT                   /db_xref="GOA:B1YHB9"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014300"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHB9"
FT                   /protein_id="ACB59651.1"
FT                   /translation="MDLRTKHTELVRRAIKQDEAAFEQLILLHNEQLYRTAYVYVKNEQ
FT                   DALDVVQETVYKAFISIGQVKEPKYFVTWLTKILIRNCYRVLNQQTAVADLIEQIPVKE
FT                   SSREEHLDLIDALSHLRKEYRDVLVLFYFHDVPMKEIASFIGITLNTVKTYLRRGREEL
FT                   KKQLGGLDYVEARSSKGV"
     ttggacttac gaacaaagca cacggagctt gtccggcgcg ccatcaagca ggacgaggca        60
     gcatttgaac aattgattct cctacataat gaacagctct accggacggc ctacgtctat       120
     gttaaaaacg agcaggatgc gctcgacgtc gtccaggaaa cggtctacaa agccttcatt       180
     tccattggac aagtcaaaga acccaaatac ttcgtgacct ggctgacgaa aattctgatt       240
     cggaactgtt accgtgttct gaaccaacag acagcggtag cggatctcat tgaacagatt       300
     ccggtgaagg aatcttcacg ggaagaacat ctcgacttga ttgatgcgtt gtcgcacctg       360
     cgaaaagaat accgggatgt tttggtgctc ttttattttc acgatgtccc gatgaaggag       420
     attgcttcgt ttatcggcat caccttgaat acggtcaaga catacctgag acgtggacga       480
     gaagaattaa aaaaacagtt ggggggactc gattatgtcg aagcacgatc ttcaaaagga       540
     gtatga                                                                  546
//

If you have problems or comments...

PBIL Back to PBIL home page