(data stored in ACNUC7421 zone)

EMBL: CP001022.PE164

CP001022.PE164       Location/Qualifiers
FT   CDS_pept        181863..183224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0165"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bld:BLi04170 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59652"
FT                   /db_xref="GOA:B1YHC0"
FT                   /db_xref="InterPro:IPR025436"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHC0"
FT                   /protein_id="ACB59652.1"
FT                   /translation="MSKHDLQKEYDQIPVPQAALQERIRQGIKQGKREQQIKRPKRLRR
FT                   LVVSTGLAASLLITSTFVIPSFATAMAKVPLLGQMYRPFLEQENTGTAIGQKQLATTIH
FT                   QVASDQGIDIQVIDAYYDGATIGMNLIATVVPDVKPEIRSGLYELFKGDQRFAGTETKE
FT                   VVQFKQVKGIWQARIEYTLGEIKLQDKIQIPVVLTDVFGVHGNWTFNVPVKRLPVTEQV
FT                   YGTTVKNPIYRTDITLNRLIQGKGSTSFDYTTRSPKKERARVEMTLLDQFGKEIIRNWT
FT                   WSTQSVKRTKTATEAVEQSRLILGNYVIPKGSYLLQPSLRIDLKTQPIPLTKPLPYREQ
FT                   SETHPLKMEITSIETTSEQVVVEFSTNSRSSQFDTKLDIRNSMYLLKGTEPPDGREIKA
FT                   KVTVLDADKQTFRATFQLPEPSEHTREEYYLETGYSNTLVNTPLELQPIPFTVD"
     atgtcgaagc acgatcttca aaaggagtat gaccagattc cggtaccgca ggccgcctta        60
     caggagcgga ttcggcaggg aataaagcag gggaagcgcg agcaacaaat caaacggccg       120
     aaacgtctgc gacgtctggt tgtttcgacg ggactggcgg catcactgtt gatcacatcg       180
     acattcgtca tcccgtcctt tgcgacggcg atggcaaaag taccgttact cggtcagatg       240
     taccgaccgt tccttgaaca ggaaaatacc ggtactgcga ttggtcaaaa acaactcgcg       300
     accaccatcc accaagtcgc aagtgatcag ggaattgata tccaggtcat cgatgcctat       360
     tacgacgggg caacgatcgg gatgaacctg atagcaaccg tggtcccgga tgtgaagcca       420
     gaaattcggt cagggctata tgaactgttt aaaggagatc aacgttttgc cgggacggag       480
     acgaaagaag tggttcagtt caagcaggtc aaagggatat ggcaagcacg aattgaatat       540
     acactcggtg aaattaaact gcaggataaa atccagattc cggtcgtgtt gacagacgta       600
     ttcggcgtcc atggaaactg gacgttcaac gttccggtca agcggcttcc tgtcactgaa       660
     caagtttacg ggacaacggt caaaaatccg atataccgga cagatatcac gctgaatcgg       720
     ttgattcagg gcaaaggcag cacctcgttc gactacacga ctcgctcgcc gaaaaaagaa       780
     cgcgcccgtg ttgagatgac gttgctcgat cagttcggta aggaaatcat ccgtaactgg       840
     acatggtcga ctcaatctgt caaacggaca aaaacggcaa cggaagccgt cgaacagtca       900
     cggttaattc tcgggaacta tgtgattcca aaagggagct atctgttgca gccttctttg       960
     cgaattgatt taaagacaca accaattccg ctaactaagc cgttaccata ccgcgagcag      1020
     tcggaaacgc atccgctcaa gatggaaatc acatcgattg agacaacatc cgagcaagtc      1080
     gtcgttgaat tttcaacgaa ttcccgctcg tctcaatttg atacgaagct tgatatccgt      1140
     aactcgatgt atttactgaa gggaacagaa ccaccggacg gtcgggaaat caaagcaaaa      1200
     gtcacggttc tcgatgcgga caaacagacg ttccgggcga cgttccaact gccggaacca      1260
     tctgaacaca cgcgggaaga atattatctc gaaacgggtt acagcaatac cctcgtcaat      1320
     acaccacttg aattacaacc gattccgttt acggtcgact aa                         1362
//

If you have problems or comments...

PBIL Back to PBIL home page