(data stored in ACNUC7421 zone)

EMBL: CP001022.PE166

CP001022.PE166       Location/Qualifiers
FT   CDS_pept        complement(183822..184379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0167"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59654"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHC2"
FT                   /protein_id="ACB59654.1"
FT                   /translation="MRKFWMICLLTAFSLSGCLAPQKETVTVTPLKLKAGEQAFAAIND
FT                   QEIAAFHLKGKLKKPYLLKGIEYLPNHKERTLFYMEIPAKTYDSTLRIVQSSSSKSVRF
FT                   GANLDGGSFRAHEDLKIKPDAVNTQNPSSEFTLTDYNVLFLRQLSADGKLSSNPFNDIQ
FT                   GPENVTVKKGEQVFAFVLTKQN"
     atgagaaaat tttggatgat ctgcttactg actgctttct ccctcagcgg ttgcctggca        60
     cctcaaaaag aaacggtgac ggtgacaccg ctcaaactaa aagctggtga acaagctttt       120
     gctgctatca atgatcagga gattgcggcc tttcacttga aaggtaaact caagaaacca       180
     tatcttttga aaggcatcga gtacttaccc aatcataaag aacggacgct cttttatatg       240
     gaaattcccg cgaaaaccta tgactcgacg ttgcggatcg tccaatcttc ctcaagcaaa       300
     tccgtccgct tcggtgccaa tttggacgga ggcagtttcc gggcgcatga agacttaaag       360
     attaaaccgg atgccgtcaa cacacaaaat ccgtcaagtg agttcacact cacggattat       420
     aatgtccttt ttctccgcca actatcagca gacggaaaac tctcgtcgaa tccgtttaat       480
     gacattcagg ggcccgaaaa cgttaccgta aaaaaaggtg aacaggtttt tgctttcgtt       540
     ctgacaaaac aaaactga                                                     558
//

If you have problems or comments...

PBIL Back to PBIL home page