(data stored in ACNUC7421 zone)

EMBL: CP001022.PE167

CP001022.PE167       Location/Qualifiers
FT   CDS_pept        complement(184457..185059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0168"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bpu:BPUM_0847 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59655"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHC3"
FT                   /protein_id="ACB59655.1"
FT                   /translation="MKKWLYISFAALVLTGCNQEQAQEPATKKAASTAYTSNLNISPVK
FT                   ITEGEEKFAALGNQQIGSVKLKGTLKTTHWLKGVEYLPNKKERTLFTLELEPKKYDTQV
FT                   RFSQSFSDDKIHLGLDVDDTTVQGDDSFKHLDDYMIRGADFRSRASAATPYNLLMVYHM
FT                   TTKNGIRGFNLNEVTRPADVPLKKGERIFGIVLSNQK"
     atgaaaaaat ggctctacat atcatttgct gctcttgtct tgaccggctg taaccaagaa        60
     caggcacagg aaccggctac gaaaaaagca gcatcaaccg cctatacatc gaacctgaac       120
     atttctcccg taaagattac ggaaggcgaa gaaaaatttg cggcgctcgg taatcagcaa       180
     atcggcagcg ttaaattaaa gggcacgtta aagactacac actggcttaa gggagtcgaa       240
     tatctgccga acaaaaaaga acgcaccctt tttacgctcg aactcgaacc taaaaaatac       300
     gatacacaag tccgcttcag tcaatcgttc tcggacgata aaattcatct tggtttggac       360
     gtggatgata caacggtgca aggagacgat tccttcaagc atctggatga ctacatgatc       420
     cggggagccg atttccgctc gcgtgcttct gccgctacac cttacaacct gctgatggtg       480
     tatcatatga caacaaagaa cggaatccgt ggctttaact taaacgaagt gacccgtccg       540
     gctgatgtac cgctcaaaaa aggtgaacgg attttcggca tcgtcctatc aaatcagaag       600
     taa                                                                     603
//

If you have problems or comments...

PBIL Back to PBIL home page