(data stored in ACNUC7421 zone)

EMBL: CP001022.PE17

CP001022.PE17        Location/Qualifiers
FT   CDS_pept        26567..28252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0018"
FT                   /product="DNA polymerase III, subunits gamma and tau"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: bha:BH0034 DNA polymerase III gamma and tau
FT                   subunits; TIGRFAM: DNA polymerase III, subunits gamma and
FT                   tau; PFAM: AAA ATPase central domain protein; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59505"
FT                   /db_xref="GOA:B1YGC8"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1YGC8"
FT                   /protein_id="ACB59505.1"
FT                   /translation="MAYQALYRVYRPQRFDEVVGQAHITRTIQNALMEERMSHAYLFSG
FT                   PRGTGKTSLAKIIAKAINCEQAPVNEPCNECPTCRAITEGSSPDVFEIDAASNNGVDEI
FT                   REIRDKVKYPPSEAAYKVYIIDEVHMLSTGAFNALLKTLEEPPAHAIFILATTEPHKIP
FT                   ATIISRCQRFDVKRHEVDQLMERMQYILSDQTIGYTETALRLIARAADGGMRDALSLLD
FT                   QAVAFSNGDLTDDAVLEVTGAVEDEALLAVANALQAHQVDQLLQTLEKMQRAGKDLKRF
FT                   VEDLVFFYRDTLLLKTSPTAVDLLERARPTEAFKTFVETIETEACFHIIEQLHDCQQQM
FT                   RLTNHPRVLVEIAFIQIAEQGRTTGQIMQSLQQEVRELKEQMHQLKVTGVPAAEGTPAQ
FT                   QPAKRKQARPTVRIAKERIRQMLSRAEKAQLLEIQERWDAILKLILKQDGPIYSLVHES
FT                   KPVLCSEDTLLIEFDNGKGWHFEQVMTNERTRFVIEEALFEVCGVKRQILAILDNDWKE
FT                   LKAEFVAKRNSSNIEEKEVAVESEEDRLLSETLGRFGDIVEFED"
     ttggcctatc aagcattata tcgtgtgtac cggccgcaac gttttgacga agtcgtcgga        60
     caggcacaca ttacccggac gattcaaaac gccttgatgg aagaacggat gtcgcatgcc       120
     tatctgttct ctggaccacg aggaacgggg aaaacaagtc tggcaaaaat cattgccaaa       180
     gcaatcaact gtgaacaagc gccagtaaat gaaccatgta acgaatgtcc gacatgtcga       240
     gcgattacag aaggatcaag tcctgatgtg tttgaaatcg atgccgcgtc caacaacggc       300
     gttgatgaaa tccgggaaat ccgggataag gtcaaatatc cgccgtcaga agcagcgtac       360
     aaagtataca tcattgatga agtccacatg ttatcgaccg gagccttcaa tgcgttactt       420
     aaaacattgg aagaaccgcc agcacacgcc attttcatcc tggcgacgac agagccgcat       480
     aaaataccgg cgacgattat ctcacgttgc caacgttttg atgtcaaacg gcatgaagtc       540
     gatcaattga tggaacggat gcagtacatc ttatcggatc aaacgatcgg ctatacggaa       600
     accgcattgc ggttgattgc ccgggcagcg gatggtggaa tgcgggatgc cttaagcctg       660
     ctcgatcagg ccgtcgcctt ttcgaatgga gacctaacgg atgatgctgt actggaagtg       720
     acgggggcag tggaagatga agcactgctc gctgtcgcaa acgcattgca agcccatcaa       780
     gtcgaccagt tgttgcagac acttgaaaaa atgcaacggg caggaaaaga tttaaaacga       840
     ttcgtcgaag atctggtctt tttctatcgc gatacgttac ttctcaaaac gtctccgaca       900
     gcagttgatc ttttggaacg ggctcggccg accgaagcgt tcaaaacatt tgtcgagacg       960
     atcgagacag aagcatgttt tcatatcatc gaacaattgc atgactgcca acagcagatg      1020
     cgtttgacga atcatccccg tgtcctggtc gaaattgcgt tcattcagat tgcggaacaa      1080
     ggacgaacga ccggacagat catgcagagt ctccagcaag aggtacggga actgaaggaa      1140
     cagatgcatc agttgaaagt cacgggagtc ccggctgctg aaggaacgcc tgcgcaacaa      1200
     ccagccaaac gcaaacaagc ccggccaact gtccggatag cgaaagagcg gattcggcaa      1260
     atgttgagtc gtgcagagaa ggcacagctt cttgaaattc aagaacgttg ggatgccatt      1320
     ttaaagttaa tccttaaaca agatggtccg atttactctt tggtgcatga aagtaaaccg      1380
     gtcctctgtt cggaagatac attattgatt gagtttgata acgggaaagg ctggcatttt      1440
     gaacaggtca tgaccaacga acggacccgt ttcgtcattg aagaagcact gtttgaggtc      1500
     tgcggtgtga aacgtcagat tcttgcgatt ctcgataatg attggaaaga actaaaagca      1560
     gagtttgttg cgaaacgaaa tagtagtaat atagaagaga aagaagtggc agtcgaatcg      1620
     gaagaagatc gactgttgtc cgagacgctc ggacgatttg gtgatatcgt agaattcgaa      1680
     gactaa                                                                 1686
//

If you have problems or comments...

PBIL Back to PBIL home page