(data stored in ACNUC7421 zone)

EMBL: CP001022.PE171

CP001022.PE171       Location/Qualifiers
FT   CDS_pept        189782..190627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0173"
FT                   /product="protein of unknown function zinc metallopeptidase
FT                   putative"
FT                   /note="PFAM: protein of unknown function zinc
FT                   metallopeptidase putative; KEGG: rba:RB133 predicted
FT                   metalloprotease"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59659"
FT                   /db_xref="GOA:B1YHC7"
FT                   /db_xref="InterPro:IPR007343"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHC7"
FT                   /protein_id="ACB59659.1"
FT                   /translation="MKWKGRERSSNVEDRRGMGGKGVAGIGGGLGIIILIVVTLMGGNP
FT                   ADILGGLSDSQGDSQGEYQETAKEKEAADFVSVVLADTEKVWTKEFKQDGMTYKEPTLV
FT                   LYTDQVSSACGQAGKSVGPFYCPGDQKLYIDLSFYDELQNKYGAPGDFAMAYVIAHEVG
FT                   HHVQTLLGTSDEIMPLRQKMSEEKFNKYLVRFELQADYYAGVWANHAQGQNLLEEGDLE
FT                   EALGAANAVGDDTLQKKGQGYVVPESFTHGTSAQRERWFQKGFDNGTIEGGDTFKAKNL
FT                   "
     atgaaatgga agggcagaga aagaagttcg aacgtcgaag atcgacgggg catgggtgga        60
     aaaggagtcg ccgggatcgg aggtggactc gggatcatca ttttaatcgt cgtcacgttg       120
     atgggcggga atccggccga catcctcgga ggattgtccg attcacaagg cgacagtcaa       180
     ggcgagtacc aggaaacggc caaagaaaaa gaagcggctg attttgtatc cgttgtctta       240
     gcggatacgg aaaaagtctg gacaaaggaa tttaaacagg acggtatgac ctataaagaa       300
     ccgacgctcg ttttatatac cgatcaggtc agttcagcgt gtggacaagc cggaaagtca       360
     gtcggaccgt tttattgtcc gggggatcag aaattataca ttgatctaag tttttatgat       420
     gagttacaaa ataaatacgg ggcaccggga gacttcgcga tggcgtatgt cattgcccac       480
     gaagttgggc accatgttca gacgttgctt gggacatcag acgaaatcat gccgcttcgt       540
     caaaagatga gcgaagagaa gttcaacaaa tacctggtcc gctttgaatt gcaggcggat       600
     tactatgcgg gtgtctgggc caaccatgca caaggacaaa atctgcttga agaaggcgat       660
     ttggaagagg cacttggagc ggcgaatgct gtcggagatg atacattgca gaaaaaaggg       720
     caaggatatg tcgtaccgga aagctttaca cacggtacat cggctcaacg cgaacgatgg       780
     ttccaaaaag gatttgataa cggaacgatt gaaggcggcg ataccttcaa agcgaagaat       840
     ttataa                                                                  846
//

If you have problems or comments...

PBIL Back to PBIL home page