(data stored in ACNUC7421 zone)

EMBL: CP001022.PE179

CP001022.PE179       Location/Qualifiers
FT   CDS_pept        complement(197535..198917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0181"
FT                   /product="amino acid permease-associated region"
FT                   /note="PFAM: amino acid permease-associated region; KEGG:
FT                   gtn:GTNG_3167 probable amino acid permease"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59667"
FT                   /db_xref="GOA:B1YHD5"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHD5"
FT                   /protein_id="ACB59667.1"
FT                   /translation="MKEHPTELRRDLKTRQLTMIAMGCAIGTGLFLGSGLAISLAGPSV
FT                   LVSYAIGAFIVLLLMGCLAEMTVAHPTSGSFGTIAEKYIGPYAGFLVRYSYWVANVLAI
FT                   GVEVSAIAIYMKYWFPDVPGYIWIFVFAAALIYINATTVNTFATFEYWFSVIKISAILM
FT                   FMILGAYLVFGSSSPEIGPQNFTNDGGFMPFGFSGLWIAVFISLFSFLGTELIAVTAGE
FT                   AKDPDVAVPKALKATVFRLSTFYVITIALMLMIVPWQQAGGVDESPFVKVMEMLSIPGA
FT                   AGIMNFIVLTAALSAMNSQLYASTRMMYSLSKATYAPRMFSRLNAKGVPLFALAVSTLG
FT                   IFLAAVISSQSSVSYPFMMGISMFGAIFTWFMIFISHLYFRKAWERDGGRKLPVRMMGY
FT                   PYLTALGALLLFALVITTWFTDFQIVLKFGIPWLIFLTIAYVFWKRNHPPQADQTNRSQ
FT                   SL"
     atgaaagaac atcctactga attacggcgt gatttaaaaa cacgccaact gacgatgatt        60
     gcgatgggct gtgcgatcgg aacgggactt ttcctcggaa gcggtctcgc catcagtctg       120
     gccggaccaa gtgttcttgt cagttacgcc atcggagcat ttatcgtcct gctgttgatg       180
     ggatgtctcg cggaaatgac cgtcgcccat ccgacgtccg gctcattcgg aacgattgcg       240
     gagaagtaca tcggtcctta tgccggcttc ctcgtgcgtt attcctactg ggtcgcgaat       300
     gtcctcgcga tcggcgtcga agtcagcgcc atcgccatct acatgaaata ctggttcccg       360
     gatgtgcccg ggtacatctg gattttcgtt ttcgcagcgg cgttgattta tatcaatgcc       420
     acgaccgtca atacgtttgc gacattcgaa tactggttct ccgtcattaa aatcagtgcc       480
     atcctgatgt tcatgattct cggcgcgtac ttagtcttcg gcagcagctc accggagatt       540
     ggtccgcaaa actttacgaa tgacggcggc ttcatgccgt tcggattctc cggtctctgg       600
     attgccgtct tcatctcgct gttcagtttc ctcgggaccg aattgattgc cgtgacagcc       660
     ggtgaagcaa aagatccgga tgtcgcagtg ccgaaagcac tgaaggccac cgtcttccgt       720
     ctgtcgacgt tttatgtcat cacgattgcc ttgatgctga tgatcgttcc gtggcaacag       780
     gccggtggtg tcgatgaaag tccgttcgtg aaagtcatgg agatgttgtc gattcccggt       840
     gcagccggca ttatgaactt catcgtcctg acagccgcct tatcggcgat gaacagtcag       900
     ctctatgctt cgacgcggat gatgtattcg ctatcgaaag ccacctatgc cccgcggatg       960
     ttcagccgcc tgaatgcgaa aggcgtaccg ctgtttgccc tggctgtttc gacgcttggg      1020
     attttcctcg ctgccgtcat cagcagccaa tcgagtgtct cttatccatt tatgatgggg      1080
     atttcgatgt tcggtgccat cttcacctgg ttcatgattt tcatctccca tctctacttc      1140
     cgcaaagcct gggaacggga cggcggacga aaactgccgg tccggatgat gggatatccg      1200
     tatttgaccg cacttggtgc gctcttgttg tttgcgcttg tcatcacgac ctggtttacc      1260
     gatttccaaa ttgtcttgaa gttcggtatc ccgtggttga ttttcctgac aatcgcctat      1320
     gttttttgga aacgaaatca tccgccgcaa gcggatcaga caaaccgttc acaatcactt      1380
     tga                                                                    1383
//

If you have problems or comments...

PBIL Back to PBIL home page