(data stored in ACNUC7421 zone)

EMBL: CP001022.PE181

CP001022.PE181       Location/Qualifiers
FT   CDS_pept        200310..200939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0183"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: gtn:GTNG_3165
FT                   transcriptional regulator TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59669"
FT                   /db_xref="GOA:B1YHD7"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHD7"
FT                   /protein_id="ACB59669.1"
FT                   /translation="MTMKSDKFKVDKRHLRTVRTREKLLVAARHVFLENDFQTTTISQI
FT                   IKRAGVGYGTAYVHFEGKDELLIVLMEDVMDRFHQVAEQPFEPGTAEEAQKQIEQQAMA
FT                   FLQLAEQEREMLRVVEQAIGISYVIRTKWKQIRERFIERISCDIRYAQRTGLARPDLNP
FT                   ALVARGWFFANEMYLFEVVREETTASIEEIAKTLTAVYTTGLYEHG"
     atgacgatga aatcagataa atttaaagtg gacaaacggc atttgcggac agtccggacg        60
     cgggaaaaat tattggtcgc agcccggcac gtctttcttg aaaatgactt ccagacgacg       120
     acgatttcgc aaatcatcaa acgggcgggc gtcggatacg gaacggcgta cgttcacttt       180
     gaagggaaag atgaactgtt aattgtgttg atggaagacg taatggatcg tttccaccaa       240
     gtggcggaac agccatttga gccgggaacg gctgaagaag ctcaaaaaca aatcgagcaa       300
     caggcaatgg cctttttaca gctggctgag caggagcggg agatgctgcg ggtcgtcgag       360
     caggcgattg gcatctctta cgtcatccgg acgaagtgga aacagattcg tgagcggttt       420
     attgaacgga tcagctgcga tatccgctat gcgcaaagaa ccggattggc tcgtccggac       480
     ctaaatccgg cactcgttgc ccgcggctgg ttttttgcca atgaaatgta tctgttcgaa       540
     gtcgttcgcg aagagacgac cgcgtcaatc gaagaaatcg ccaaaacctt aactgctgtg       600
     tatacgaccg gactgtacga acacggttaa                                        630
//

If you have problems or comments...

PBIL Back to PBIL home page