(data stored in ACNUC7421 zone)

EMBL: CP001022.PE190

CP001022.PE190       Location/Qualifiers
FT   CDS_pept        209412..209630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0192"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59678"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHE6"
FT                   /protein_id="ACB59678.1"
FT                   /translation="MHRCVQKNGRPFDLIEADETKQRWWILNPPPLFVVRNQTSKKASV
FT                   FYDSVWGGNEKKDALTIMMGLDWRGQG"
     atgcaccgat gcgtccagaa gaacggaaga ccgtttgatt taatcgaagc ggatgaaacg        60
     aaacaaaggt ggtggatact aaatccgcca cctttgtttg tcgttcggaa tcaaacatca       120
     aaaaaagcgt ccgtctttta cgattccgtt tggggaggga atgaaaagaa ggacgcttta       180
     actattatga tggggcttga ttggcgcgga caggggtag                              219
//

If you have problems or comments...

PBIL Back to PBIL home page