(data stored in ACNUC7421 zone)

EMBL: CP001022.PE191

CP001022.PE191       Location/Qualifiers
FT   CDS_pept        complement(209651..210208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0193"
FT                   /product="nitroreductase"
FT                   /note="PFAM: nitroreductase; KEGG: bsu:BSU08480
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59679"
FT                   /db_xref="GOA:B1YHE7"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR026021"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHE7"
FT                   /protein_id="ACB59679.1"
FT                   /translation="MNTRQLILERRSVRAYTDQPVPNEMIEEILEAAIYAPTHKLREPW
FT                   RFVLVNEESQERYVDQLMTLLAKRGQLDQKTDEQRQMMRQKFADVPVYLTVLYEVKGTE
FT                   DQQMEDLLATAAMIQNVQLLATELGLGCCWKSGKHWFTEEYAEMIGASENERVAGIIQF
FT                   GWPALIPPLKKRTAARDKLTHF"
     atgaacaccc gacaactgat tttagaacga cgatccgtcc gtgcttacac cgatcagccg        60
     gttccaaatg aaatgattga agaaattctc gaagccgcca tctatgctcc gactcataaa       120
     ttgcgtgaac cttggcgatt tgtcctcgtt aacgaagaaa gccaagagcg gtatgtcgac       180
     caattgatga cgctgcttgc caagcgggga cagctggatc aaaaaacaga cgaacaacgc       240
     cagatgatgc gtcaaaaatt tgcagatgtt cctgtttatt tgaccgtttt atatgaagta       300
     aaaggaacag aggatcagca gatggaagat ctgctcgcga ctgctgccat gattcaaaac       360
     gttcagcttc tcgcgactga actgggtctc ggctgttgct ggaaaagcgg aaaacattgg       420
     ttcacggagg aatatgccga aatgatcggc gcttccgaaa atgaacgtgt cgcaggaatc       480
     atccaattcg gatggcccgc cttaattcct ccgctgaaaa aacgaacggc agcacgtgac       540
     aagttaacgc acttctaa                                                     558
//

If you have problems or comments...

PBIL Back to PBIL home page