(data stored in ACNUC7421 zone)

EMBL: CP001022.PE195

CP001022.PE195       Location/Qualifiers
FT   CDS_pept        213525..214133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0197"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: bcy:Bcer98_3256
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59683"
FT                   /db_xref="GOA:B1YHF1"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR039532"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHF1"
FT                   /protein_id="ACB59683.1"
FT                   /translation="MNSGQDPRPKRSRDRITKELFRLLDSHPFSTITVKMLTDGAAVNR
FT                   STFYAHFTDKYDLMNQIVDDHMRLLMEAIRIQGTGAPAAPSLDRVSRYFERLFIHIEQH
FT                   EQFYRTMLLNGPVKTFISRFLDTLKENYQRVFEAHTVTETQLVDRDLLLNYVIGGQLGL
FT                   LISWLRNGRPYSAAYMADQLSRMIVFGTVKSIGFPEQST"
     atgaattcag gacaagatcc acgaccaaag cggtcacgtg accgtattac aaaagaatta        60
     tttcgtttgc tggacagtca tcctttttcg acgattaccg tcaagatgtt aacggacgga       120
     gcggcggtca atcgatcgac cttctatgcg cactttacgg ataaatatga tttgatgaat       180
     cagattgtag acgatcatat gcggcttctg atggaagcaa tccggattca gggaaccgga       240
     gcaccggctg ctccgtcgct cgatcgagtc agccgttact tcgaacgact gttcatccat       300
     attgaacaac atgaacaatt ttaccggacg atgttgctga acggtccggt caaaacgttc       360
     atctcgcgtt ttctcgatac gttaaaggaa aattatcagc gggtgttcga agcgcacacg       420
     gtaacggaaa cccaactggt cgatcgtgat ttattgttga attacgtgat cggcggacag       480
     ctcgggctac tgatttcctg gttacgaaac ggtcgtcctt attcggcggc ctacatggca       540
     gatcaactca gccggatgat tgttttcgga acagtcaaga gcatcggttt tccggaacaa       600
     tcgacttaa                                                               609
//

If you have problems or comments...

PBIL Back to PBIL home page