(data stored in ACNUC7421 zone)

EMBL: CP001022.PE196

CP001022.PE196       Location/Qualifiers
FT   CDS_pept        complement(214184..215284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0198"
FT                   /product="diguanylate cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; 5TM Receptors of the LytS-YhcK type
FT                   transmembrane region; KEGG: bld:BLi02306 YhcK"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59684"
FT                   /db_xref="GOA:B1YHF2"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR011620"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHF2"
FT                   /protein_id="ACB59684.1"
FT                   /translation="MSIMNNFIINFCLLFTTITLLFLPFRNHPRITPKTNLNVRLVLGG
FT                   IAGLISVLLMLNSIQIDVARIDLRIVPVVIAMMFGGLPSALVTGAMIIVTRFILTPVEQ
FT                   MDAAVVSTIVIGVLILTIAVVRRYIRLTFWNFELMIGIGIVYSLPGIYLLTNSWTTFIE
FT                   ISLAYIFFNLIAGFVTYHLLTELRRHFENIQYQQKLAMTDALTGLANRRRLDDSLSLVG
FT                   SAEEGYSLILIDIDFFKHVNDTYGHDAGDDVLRQLGTTLASLARPDDLVGRYGGEEFLI
FT                   ILPNTSLADAKSIAELARTTVARNLFPTTAVPDLQITISLGIAHSSSSHTSLEALQQAD
FT                   KALYHSKDSGRNRSTTYTKQLQLEQA"
     ttgtccatca tgaataattt catcatcaat ttttgtctac tgtttacaac gattactctt        60
     ttgtttctgc cttttcgaaa tcatccgcgg attacaccga aaacgaacct gaacgttcga       120
     ctcgtgttag gaggcatcgc cggcctgatt tctgtcctat taatgctcaa cagcatccag       180
     attgatgtcg cccggattga tttacggatt gttcctgtcg tcatcgccat gatgttcggc       240
     ggtttaccga gcgctctcgt caccggtgcg atgattatcg tgacacgttt tatactgaca       300
     ccggtcgaac aaatggatgc cgctgtcgtg tcaacaatcg tcatcggagt gttaatcctg       360
     acgattgccg tcgtccgtcg ctatatccgg ttgaccttct ggaacttcga actgatgatc       420
     ggcatcggta tcgtctattc gttaccgggc atctatctgc tgacgaacag ctggacgacc       480
     ttcatcgaga tttccctggc ttacatattc tttaacctga ttgccggttt cgtgacctat       540
     catctgttga cagagttacg acgacacttt gaaaatatcc agtaccagca aaaactggcc       600
     atgaccgacg ccttgacagg gctcgccaac cgccgccggc ttgatgactc cctgtcactc       660
     gtcggttcag cagaagaagg ctactcgctg atcctgattg acattgattt ctttaagcac       720
     gtcaacgata catatggtca tgacgccggt gacgacgtct tgcggcaact cgggacgacg       780
     ttagcctcac tggcacgacc ggatgatctg gtcggacgtt acggcggcga agaattttta       840
     atcattctcc cgaacacctc actcgccgat gcgaagagca tcgcggaact tgcccggacg       900
     acggttgccc gaaatctgtt tccgacgaca gccgtccctg atctgcagat tacgatttct       960
     ctcggcatcg cgcactcgag cagctcgcat acgtctcttg aagccttaca gcaggcagat      1020
     aaagcgctgt atcattcgaa ggacagtgga cgcaaccgga gcacgaccta taccaaacaa      1080
     ttgcaactcg aacaggcctg a                                                1101
//

If you have problems or comments...

PBIL Back to PBIL home page