(data stored in ACNUC7421 zone)

EMBL: CP001022.PE197

CP001022.PE197       Location/Qualifiers
FT   CDS_pept        complement(215468..215917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0199"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; KEGG: btl:BALH_1242
FT                   transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59685"
FT                   /db_xref="GOA:B1YHF3"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHF3"
FT                   /protein_id="ACB59685.1"
FT                   /translation="MPQERDQLTYRLEEQMRIILRTLRRELNRLFEGTATRSEFFILRS
FT                   LSENGPQRPTLLAEQFELATSQVTALTDRLYKAGFVTRTRSTDDRRSIVLALTEEGESA
FT                   FRELEIVRRKYLQDRFGTLTEEELNAMVLVFDKILLTMDEEAISS"
     atgccacaag aacgtgatca actgacttat cgattagagg aacaaatgcg gatcattctc        60
     cggacattac gccgtgaact caaccgactg tttgaaggga ccgcgacacg aagtgaattt       120
     ttcattttac gcagtctgtc cgaaaatggt ccccaacgtc cgactctact cgcagagcag       180
     tttgagcttg cgacaagtca ggtaacagct ttgactgatc gtctgtacaa agccggattc       240
     gtcacgcgga cgcgctcgac ggatgacaga agatcgattg ttttagcact gacggaagaa       300
     ggagaatccg ctttccgcga acttgaaatc gtccgccgga aatatctcca agatcgtttc       360
     ggcaccctga cggaagaaga gctgaatgcg atggttctcg tcttcgataa gatcctcttg       420
     acgatggatg aagaagcgat ttcttcctaa                                        450
//

If you have problems or comments...

PBIL Back to PBIL home page