(data stored in ACNUC7421 zone)

EMBL: CP001022.PE199

CP001022.PE199       Location/Qualifiers
FT   CDS_pept        218010..218192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0201"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59687"
FT                   /db_xref="GOA:B1YHF5"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHF5"
FT                   /protein_id="ACB59687.1"
FT                   /translation="MNYWYHFKRAFIPIAILLVTLAIYQMLYRMNNMWYSFGGLILVFA
FT                   AIYFVMRRLKANPED"
     gtgaactatt ggtatcactt taaacgggca ttcatcccga ttgcgatttt acttgtgacg        60
     ttagcaatct atcagatgct gtaccgcatg aataacatgt ggtattcgtt cggtggatta       120
     attttagtat ttgcggcgat ttattttgtc atgcgccgct taaaagcgaa tcccgaagat       180
     tga                                                                     183
//

If you have problems or comments...

PBIL Back to PBIL home page