(data stored in ACNUC7421 zone)

EMBL: CP001022.PE201

CP001022.PE201       Location/Qualifiers
FT   CDS_pept        219273..220562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0203"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xfa:XF1486 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59689"
FT                   /db_xref="InterPro:IPR018721"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHF7"
FT                   /protein_id="ACB59689.1"
FT                   /translation="MFTQVYEEIRQLTISKVLDFYDHEVRRLDEAARQTKYQKMSASPF
FT                   LFFRGSSHLFYYDVTRIPLGFDTPPETPTWIQGDLHFENFGVHGNAKGEIIYDVNDFDE
FT                   GYLGSYLYDLIRMAVSVQLFAEEAGYDAKPAIAAYVQHYLDDLRQYAKGKNPSKVCFTT
FT                   DNTKGPIRKLIKKAEKKKAELLGERTTVVDGQRRFADLPDMKRLDSSAYTAIEAVWPEY
FT                   IASIDAEDRQEDGFYAIKDIVYKLDSGTASIGLERYYILVEGTGGEHEDLILEMKQAQS
FT                   SVPSLFVPAYLQEVETVHQGRRIVTSQKAMQAHEDPYLGYVTMHGKEYYVRERSPYKKK
FT                   LKAKHIKSQDDLENVLSIQGQITAKIHARADMDAGVDVDILHHHADVVIIESIGVSDAE
FT                   FIRQIQRWSSAYAARTTLDFQVFLSWLANR"
     atgttcacgc aagtctatga ggaaattcgg caactgacaa tctcaaaagt actcgatttc        60
     tacgatcatg aagtccgcag actcgatgaa gcggcacggc aaacgaagta tcaaaagatg       120
     agtgcaagtc cgtttctctt tttccgcggc agttcccatc tgttttatta tgacgtgacc       180
     cggattccgc tcggatttga tacgccgcct gagacaccga cctggattca aggggatctc       240
     cacttcgaaa attttggagt ccacggcaat gccaaaggag aaatcattta tgacgtcaat       300
     gactttgacg aagggtatct cggatcctac ctgtacgatt taatccggat ggccgtctcg       360
     gttcaactgt tcgcagaaga agccggatat gatgccaagc cggccattgc cgcctatgtt       420
     caacactact tagatgactt acgccaatat gcgaaaggaa aaaatccgag caaagtctgt       480
     tttacgactg acaatacaaa aggaccgatc cgtaaattga tcaaaaaagc ggagaaaaag       540
     aaagcggaat tactcggaga gcggacgacg gtcgtcgacg gacaacgccg gttcgccgac       600
     ttaccggata tgaagcggct tgattcttcc gcttacacag cgattgaagc ggtttggccg       660
     gagtacatcg catcaatcga tgctgaggac cggcaggaag atggattcta cgccatcaag       720
     gatatcgtct ataaactcga cagcggaacg gcttcgattg gtcttgagcg ctactatatt       780
     ttggtcgaag gaacaggagg agagcatgaa gacctgattc ttgagatgaa acaagcccag       840
     tcatccgttc cgtcactgtt tgtacccgcc tatttgcagg aagtcgaaac ggttcaccaa       900
     ggtcgtcgga tcgtaacttc acaaaaggcg atgcaggcac atgaagatcc gtatctcggt       960
     tacgtgacga tgcatgggaa agaatattat gtccgggaac gttccccata caaaaaaaag      1020
     ttgaaagcca agcacatcaa aagccaagat gacctcgaaa acgtcctttc aattcaaggt      1080
     caaattaccg ccaaaatcca cgcacgggcc gacatggatg cgggagttga tgtcgatatc      1140
     ttacatcatc atgcagacgt cgtcatcatc gaatcaatcg gtgtatctga cgctgagttc      1200
     attcgtcaaa ttcagcggtg gtcaagtgcc tatgcagcgc gtacaacgct tgatttccaa      1260
     gtgtttttaa gttggttagc taaccgctga                                       1290
//

If you have problems or comments...

PBIL Back to PBIL home page