(data stored in ACNUC7421 zone)

EMBL: CP001022.PE202

CP001022.PE202       Location/Qualifiers
FT   CDS_pept        220793..222226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0204"
FT                   /product="amino acid permease-associated region"
FT                   /note="PFAM: amino acid permease-associated region; KEGG:
FT                   reh:H16_A0277 APC transporter, CAT family"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59690"
FT                   /db_xref="GOA:B1YHF8"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHF8"
FT                   /protein_id="ACB59690.1"
FT                   /translation="MSLTRKKDVSAMIAASQRNSGLARNLGAMDLTFLGIGAIIGTGIF
FT                   VLTGTGALTAGPGLIVSFILSAIACGLAALAYAEFASTIPVSGSVYTYTYATMGEIFAW
FT                   IIGWNLILEYGLASSAVAAGWSGYFQSLLGGFGIHLPTALSAAPGAVEGAKTFFNLPAF
FT                   LILLAITGLLSMGIKETKRVNNIMVIIKLAVVVLFIVVGVGYVEPTNWAPFTPFGWGGV
FT                   FSGAAIVFFAYIGFDAVTSAAEEVREPQKNLPRGIIGSLAVCTVLYVIVAAIMTGIVPY
FT                   QKFAGVDHPVSLAIQMAGQNWVAGFIDLGAILGITTVILVMTYGMVRLAFAISRDGMFP
FT                   KVFSEVHPKYKTPFKATWMIGLGSATVAGLVPLDVIANLVNMGTLAAFVLISVAVLILR
FT                   KTQPDLPRAFKCPGMPYVPIAAIASCLFLMFNLKLETWIAFFIWLAIGLVLYFAFARKN
FT                   SNLEPGNMPAAELAASDDK"
     atgagtttga cgcggaaaaa agatgtttcc gctatgattg ctgcgagtca gcgtaacagt        60
     ggacttgctc gaaatcttgg cgcaatggat ttaacgtttt taggaattgg cgccatcatt       120
     ggtacaggga ttttcgtcct aaccggaaca ggagcattga cagcaggacc tggtcttatc       180
     gtctcattca ttttatctgc cattgcctgt gggttagcag cactcgctta tgcggaattc       240
     gcttcgacga ttccggtcag tggttccgtc tacacgtata cgtatgccac gatgggagaa       300
     attttcgctt ggatcatcgg ttggaactta atcttggaat atggactcgc ctcgagtgcc       360
     gttgcggcag ggtggtcagg ttacttccag tccttactcg gtggattcgg tattcatctt       420
     ccgacagcac tctcagcagc tcctggcgcg gtagaaggtg ctaaaacatt cttcaactta       480
     ccggccttcc tgattttact cgcaattaca ggtcttttat caatgggaat caaggaaaca       540
     aaacgtgtca acaacatcat ggttatcatt aaattggcag tcgttgtttt attcatcgtc       600
     gttggtgtcg gctatgttga acctacgaac tgggcaccat ttacaccgtt cggatggggc       660
     ggcgtattct ctggagcagc catcgtcttc tttgcttaca tcggatttga tgctgttaca       720
     tcggcagcag aagaagtacg tgagccgcaa aagaacttgc cacgcggtat catcggttcc       780
     cttgctgtct gtacagttct ttacgtcatc gttgcagcca tcatgacagg aatcgtcccg       840
     taccaaaaat ttgcgggtgt cgatcacccg gtctcactcg ccattcaaat ggctggacaa       900
     aactgggttg caggattcat cgatttaggt gccatcctcg ggattacaac cgttatcctc       960
     gtcatgacat acggaatggt acgtttagcg ttcgccatct cacgtgacgg catgttcccg      1020
     aaagtatttt cggaagtaca tccaaaatac aaaacaccgt tcaaagcaac atggatgatt      1080
     ggtcttggta gtgcgacagt cgcaggactc gttccactcg atgtcatcgc aaacctcgtt      1140
     aacatgggga cactcgcagc attcgtctta atctctgttg cggtcttgat ccttcgtaaa      1200
     acacaaccgg atcttccacg tgcattcaaa tgcccgggaa tgccgtacgt gccgatcgca      1260
     gcaatcgctt cttgtctctt cttgatgttc aacttgaaac tcgaaacatg gattgctttc      1320
     ttcatctggc tggcgattgg acttgtcctg tacttcgcct ttgcccgaaa gaactcgaat      1380
     ctggaaccgg gaaatatgcc ggctgccgaa ctcgcagctt cagacgacaa ataa            1434
//

If you have problems or comments...

PBIL Back to PBIL home page