(data stored in ACNUC7421 zone)

EMBL: CP001022.PE204

CP001022.PE204       Location/Qualifiers
FT   CDS_pept        complement(223972..224940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0206"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: Semialdehyde dehydrogenase NAD - binding;
FT                   oxidoreductase domain protein; Oxidoreductase domain; KEGG:
FT                   csa:Csal_2663 oxidoreductase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59692"
FT                   /db_xref="GOA:B1YHG0"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHG0"
FT                   /protein_id="ACB59692.1"
FT                   /translation="MIRTALIGFGLAGEHLHAPYLTAPDYQLVAVQSSRPEAVATRYPD
FT                   VPVYSSLEELLAAETIELVVIATPNAEHYPLAKTALSAGCHVLVEKPFTVTLLEAEQLT
FT                   DLARQQNRLLTVYHNRRYTKDFRTLLELVQADELGVVQTFEAHYDRYRPTVRARWREQD
FT                   VPGAGLLYDLGSHLIDQALMLFSERPDRVFCDQTIQRPDGPVEDYTHLILAFGTRRAIL
FT                   HIGSLVPAPGPSLAVHGTKASYFVDSVDTKRSTYTWGRPEQPLEERPFVDSGFADYYHD
FT                   LAHALRHESPLTVTTEQALLVMKIIDCAQKSVKEGTWIEVD"
     atgattcgta ctgctctaat tggctttgga cttgccggtg aacatctgca cgccccgtat        60
     ctcacagcac ctgattatca actggttgcg gttcagtcca gtcgtccgga ggcagtcgct       120
     acgcgttatc cggatgtgcc ggtctattct tcgcttgaag agttgttggc tgctgaaacg       180
     attgaactcg ttgtgatcgc gacaccgaac gccgaacatt atcccctcgc caagacggca       240
     ctttcagccg gctgtcatgt cctcgttgag aaaccattta cggtcacgtt actggaggcc       300
     gaacagttga cggatcttgc ccgtcaacaa aatcgattac tgacagttta ccataaccgc       360
     cggtacacaa aagacttccg gacattgctc gaactggttc aagctgatga actgggtgtc       420
     gtccagacct tcgaggcgca ctatgaccgc tatcgtccga ccgttcgggc acgctggcgg       480
     gaacaggacg tcccaggcgc cggtctgctt tacgatttag gttcccattt aattgaccag       540
     gcgttgatgt tgttcagtga acgaccggat cgcgtctttt gtgatcagac gatccaacgt       600
     ccggacggtc cggtcgaaga ctacacgcat ctgattctcg ctttcggaac gcgccgcgcc       660
     attctgcata tcggatcact cgttccggca cccggtcctt cgctcgccgt ccacgggaca       720
     aaagcgagtt atttcgtcga cagcgtcgat acgaaacggt cgacttatac gtggggaaga       780
     cctgaacagc ctttggaaga acgccccttc gtcgattccg gttttgccga ctactatcat       840
     gatttggcac acgccttgcg tcatgagtcc cctcttaccg tcacaacgga acaagctctg       900
     ctcgttatga aaattattga ttgtgctcaa aaaagtgtaa aagagggtac atggatagaa       960
     gtagattaa                                                               969
//

If you have problems or comments...

PBIL Back to PBIL home page