(data stored in ACNUC7421 zone)

EMBL: CP001022.PE205

CP001022.PE205       Location/Qualifiers
FT   CDS_pept        224996..225262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0207"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bpu:BPUM_3442 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59693"
FT                   /db_xref="InterPro:IPR035218"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHG1"
FT                   /protein_id="ACB59693.1"
FT                   /translation="MITEQQVIEKMRQTMSKIEQSSGTGQIEQIAAMKAYCELLLDQPQ
FT                   SVREPSVITPTTQPKPPEVDPMLARFMGVAPEKEEKGPSLLDF"
     atgattacag aacaacaagt cattgaaaaa atgcggcaga cgatgtcaaa aatcgagcag        60
     tcgagcggga cgggacaaat cgaacaaatc gcggcgatga aggcctactg tgaattattg       120
     ctggatcaac cgcaaagcgt tagggagcct tcggtcatca cgccgaccac tcaaccgaaa       180
     ccgcccgaag tcgatccgat gttggcccgc ttcatgggag tcgctccgga aaaagaagaa       240
     aaagggccct cgctgcttga tttttga                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page