(data stored in ACNUC7421 zone)

EMBL: CP001022.PE21

CP001022.PE21        Location/Qualifiers
FT   CDS_pept        40787..42196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0022"
FT                   /product="Arginine decarboxylase"
FT                   /EC_number="4.1.1.19"
FT                   /note="PFAM: Orn/Lys/Arg decarboxylase major region; KEGG:
FT                   gtn:GTNG_0022 lysine decarboxylase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59509"
FT                   /db_xref="GOA:B1YGD2"
FT                   /db_xref="InterPro:IPR000310"
FT                   /db_xref="InterPro:IPR008286"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036633"
FT                   /db_xref="UniProtKB/TrEMBL:B1YGD2"
FT                   /protein_id="ACB59509.1"
FT                   /translation="MPIIEALCAHVERNATSWHVPGHKNGTLFEGLPSFFEWDKTELRG
FT                   LDDFHYPEEAIYEAKLLLRQVYEARDSHFLINGSTVGNWAMLAAVSQRGDRIYVQRNSH
FT                   KSVFNALEWLGLSPILLGPEIDPSTGISGNVSRETLEEALTTFPGGVAVFLTSPTYYGE
FT                   TARIEELLPFTTASGIPLLIDEAHGAHFGEAFGVRSAFELGATAVVQSAHKTLPALTMG
FT                   AWIHERFTDDERRRLTRALQAFQTSSPSYLLMASLDFAREYREKWTVSNMKSVRTSHEH
FT                   LHQQINQLTDITAFTFDDWSRMILSCEEYSGSQLIEALADQGLDAEFALGPHVVCILPL
FT                   RSIEPFEQDTWINQIQLAIETLKAEGIPDKRYMEQPFMGKIKVSSLACPLDQLEDAEAV
FT                   EQTFEQSVGLVSLETIIPYPPGIPLILRGERITAEHITMIEHYINTSIHLQGGEFLHQG
FT                   KLRVIQEGIRE"
     atgccgatta ttgaagcact ttgtgctcat gtagaaagaa atgctacttc ctggcatgtt        60
     ccaggacata aaaatggaac attgttcgaa ggattaccgt cttttttcga atgggataaa       120
     acagaattgc gagggttgga tgattttcat tatccggaag aggccattta tgaagcaaaa       180
     ctcttattac gtcaagtcta tgaagcacgt gacagtcatt tcttgattaa tggatcgaca       240
     gttggtaatt gggcaatgtt agctgcggtc tcacagcggg gagaccggat atacgttcag       300
     cgtaattccc ataaatcagt ttttaatgcg ttggaatggc ttgggttatc tccgatttta       360
     ttgggaccgg aaatagatcc ctccacaggt atcagcggaa atgtttcacg tgaaacattg       420
     gaggaagcgt taacgacttt tccgggaggc gttgcggtct ttttaacttc gccgacctat       480
     tacggtgaaa cggctcgaat cgaggagttg cttccattca cgacagcatc gggtatacca       540
     ttgttgattg acgaagccca tggtgctcat ttcggggaag cttttggcgt tcgttcagcg       600
     tttgaactgg gagccactgc tgttgttcaa tcggcgcaca agacgttacc tgctctgaca       660
     atgggagcct ggatccatga acgctttacg gatgacgaac ggagacggtt aacaagggct       720
     cttcaggcct ttcaaacgtc cagcccgtcg tatctgttga tggcttcact cgattttgct       780
     cgtgagtatc gtgaaaaatg gacggtttcc aatatgaagt ctgtccggac cagtcacgaa       840
     caccttcatc aacaaatcaa tcaattaaca gatataacgg cgtttacgtt cgatgattgg       900
     tcacggatga ttttgtcctg tgaggaatat tccggaagtc agttaatcga ggcgttggcg       960
     gatcaaggac tggatgctga gtttgctctc ggaccccatg tagtttgtat attaccgcta      1020
     cgaagtatcg agccatttga acaggatacc tggattaatc agatccaatt agcaatcgaa      1080
     accttaaaag cggaaggaat tccggataaa aggtatatgg aacaaccgtt tatgggtaaa      1140
     ataaaggtat cgtccctggc ttgtccgctc gatcaattgg aagacgctga ggcggtcgaa      1200
     caaacttttg aacagtcagt cggattggtt tcacttgaaa caatcattcc ctatccgccc      1260
     gggataccac taatcctacg gggagaacgg ataacagcag aacatattac aatgattgaa      1320
     cattatataa acacatcaat tcatctgcag ggcggtgagt ttctccatca ggggaaatta      1380
     cgtgtgatac aggaaggaat tagagaatga                                       1410
//

If you have problems or comments...

PBIL Back to PBIL home page