(data stored in ACNUC7421 zone)

EMBL: CP001022.PE211

CP001022.PE211       Location/Qualifiers
FT   CDS_pept        complement(229714..231342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0213"
FT                   /product="ABC-1 domain protein"
FT                   /note="PFAM: ABC-1 domain protein; KEGG: swo:Swol_1468
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59699"
FT                   /db_xref="GOA:B1YHG7"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHG7"
FT                   /protein_id="ACB59699.1"
FT                   /translation="MKRWALYRIFIIVTMFARYIWTIYRFTRKNRPGTNNEEFERIMIT
FT                   IARDYKKKALRLEGLLIKLGQFLSIRADLFPPSVLMELTELVDKVPSSKLGESRKIIEE
FT                   DWGTAIEDIVDDISPRPIASASIGEVYSATLKSNGRKVAIKVQRPNIEQIIKTDFRAMR
FT                   LVIAMLRRTSLNKSTDLQSLYRQMVFVIGDELNYRTELKNGLYFKKMYETNPVIYIPDY
FT                   FEEHCTNRVLVMEWIEGTRITDLDYLAEHNIDRDELARNLFLNAGEQLLFGGKFHADPH
FT                   PGNVLVQSDGRIVLLDFGMIGATTADDMRAIQRILQSFVTLDYDAIVDGLEDLRFLLPN
FT                   ANKQNIRQAIEKAVTFYLESDMENIDTKLIEKVLSDIELLVRNEPIQLPAEFAFFGRAA
FT                   STILGILQILSPKINLLELAKPMVRRWLDEEGKNQNRYLQIAGSYGARLLAFPRLVNDA
FT                   LSEPTRWRLFEQQKFSRVANMESLKIRQWTSSLVGIVSLPVSYTGYFLAHYDLMGISLA
FT                   IAIVALWNGRRIGRQIVRIADEPFK"
     atgaaacgtt gggcgcttta tcggattttc atcatcgtaa cgatgttcgc tcgttacatc        60
     tggacgattt atcgattcac ccggaagaac cgacccggta cgaataatga agaatttgag       120
     cgcatcatga ttacgattgc gcgtgactat aagaaaaaag cccttcgtct cgaaggactc       180
     ctcattaaac tcggtcagtt cctgtcgatt cgggccgacc tgtttcctcc atccgtctta       240
     atggagctga cggaacttgt cgataaagtc ccgtcaagca aactcggtga atcccggaaa       300
     atcatcgaag aggactgggg aacagcgatc gaagatatcg tcgatgatat ttccccccga       360
     ccgattgctt ctgcttcgat cggtgaagtc tacagcgcaa ccctgaaatc caatggacgc       420
     aaagtagcga ttaaagtgca acggccgaac atcgaacaaa ttatcaaaac cgatttccgg       480
     gcgatgcgac tcgtcattgc gatgctccgc cggacgtcgc tcaataaatc aaccgattta       540
     cagagtctgt accgtcaaat ggtcttcgtc atcggagatg agctgaacta tcggacagaa       600
     ttaaaaaacg gtctctactt caaaaaaatg tacgaaacga atccggtcat ctatattcca       660
     gattactttg aagaacattg tacgaaccgt gtccttgtca tggaatggat tgaagggaca       720
     cgcatcacgg atcttgatta cttagcggaa cataacatcg accgcgatga actggcccgg       780
     aacctgttcc tgaatgccgg ggaacagtta ttgttcggcg gaaaattcca tgccgatccc       840
     catccgggta atgtccttgt ccaaagtgac ggccggatcg tcctgctcga cttcgggatg       900
     atcggtgcga cgacggctga tgacatgcgc gcgatccagc gaattctgca gtcgttcgtg       960
     acgctcgact acgacgccat cgtcgacggt ctagaagatt tgcgcttttt actgccaaat      1020
     gccaacaaac aaaatatccg gcaagcgatt gaaaaagccg ttaccttcta tcttgaaagt      1080
     gacatggaaa acattgatac gaagttgatt gaaaaagtat tatccgatat tgaattactg      1140
     gtccgaaacg aaccgatcca actcccggca gagtttgcct ttttcggccg ggctgcctca      1200
     acgattctcg gaattctgca aatcttatca cctaaaatca atttgctcga acttgctaaa      1260
     ccgatggtcc gaagatggct cgatgaagaa ggaaaaaatc agaatcgcta cttgcaaatc      1320
     gccggttctt acggggcacg gctgcttgcc ttcccccgcc tcgtcaacga tgccttgagc      1380
     gaaccgaccc ggtggcgact gtttgaacaa cagaagtttt cccgcgtcgc taacatggaa      1440
     tcgctgaaaa tccgtcaatg gaccagctcc ctcgtcggaa tcgtcagcct cccggtcagt      1500
     tacaccggct acttccttgc tcattatgat ttgatgggca tttcgctcgc cattgccatc      1560
     gttgctttat ggaacggtcg acgcatcgga cggcaaattg tccggattgc cgacgaaccg      1620
     tttaaataa                                                              1629
//

If you have problems or comments...

PBIL Back to PBIL home page