(data stored in ACNUC7421 zone)

EMBL: CP001022.PE212

CP001022.PE212       Location/Qualifiers
FT   CDS_pept        231509..232120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0214"
FT                   /product="protein of unknown function UPF0126"
FT                   /note="PFAM: protein of unknown function UPF0126; KEGG:
FT                   gtn:GTNG_1178 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59700"
FT                   /db_xref="GOA:B1YHG8"
FT                   /db_xref="InterPro:IPR005115"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHG8"
FT                   /protein_id="ACB59700.1"
FT                   /translation="MSWDLLNIIGTVAFAMSGAIVAMEEKYDLFGVWLLALITAFGGGA
FT                   IRNLLIGVPVSALWSQGGLFLIAILVALLIFILPQLFLPHWTRWGVLADALGLSAFAIQ
FT                   GALMASAKGLPLSATISAAVLTGVGGGVIRDLLAGRKPLVLHKEIYAMWAVMAALVIDR
FT                   FELTNPLHLFTLLGLITILRMLSYYYEWNLPARRLGGDKE"
     atgtcctggg acttgttgaa tatcatcggc acggtggcgt ttgcgatgag tggcgcgatt        60
     gtcgcgatgg aagaaaagta tgatttgttt ggcgtttggc tgcttgcttt aatcacggcc       120
     ttcggcggtg gtgccatccg caacctgttg attggtgtcc cggtttctgc gctttggtcg       180
     caaggcggac tgtttttaat cgcgattttg gtcgcgttgc tgatcttcat tttaccgcaa       240
     ttatttttac cgcactggac gcggtggggg gtgctcgctg atgcactcgg tttatccgcc       300
     tttgcgattc aaggtgcgtt gatggcttcc gctaaaggcc tgccgttatc ggcaacgatc       360
     tcggcagctg ttttaacagg agtcggtggt ggcgtcatcc gcgatctact cgccggacgt       420
     aaaccgcttg tcctgcataa agaaatctat gcgatgtggg ccgtcatggc ggcacttgtg       480
     attgaccggt tcgaattgac gaatccactc catttgttca cattactcgg tctgatcaca       540
     attttacgta tgctatccta ttattatgaa tggaatttac cagcacgacg tttaggggga       600
     gataaggaat ga                                                           612
//

If you have problems or comments...

PBIL Back to PBIL home page