(data stored in ACNUC7421 zone)

EMBL: CP001022.PE213

CP001022.PE213       Location/Qualifiers
FT   CDS_pept        232117..232485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0215"
FT                   /product="protein of unknown function DUF423"
FT                   /note="PFAM: protein of unknown function DUF423; KEGG:
FT                   bcl:ABC3922 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59701"
FT                   /db_xref="GOA:B1YHR7"
FT                   /db_xref="InterPro:IPR006696"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHR7"
FT                   /protein_id="ACB59701.1"
FT                   /translation="MKIFIMIGALSMMLAVALGAFGAHALKDMLSERMLANWQTGVLYQ
FT                   MVHSLGILALGGMLLKVSISQFSLAGWLMLAGIVFFSGSLYVMALTGVTKLGAVTPIGG
FT                   VLFIAAWIFVAIGAYKGL"
     atgaaaattt tcatcatgat cggagcatta tcgatgatgc tcgccgtggc actgggagcg        60
     ttcggtgcgc atgccttaaa agatatgtta tcagagcgga tgcttgcgaa ctggcagacg       120
     ggtgtcttgt atcaaatggt tcactcgctc ggaattctcg cactcggcgg gatgttattg       180
     aaagtatcga tttctcagtt ctcattggcc ggttggctga tgcttgccgg aatcgttttc       240
     ttctcaggca gcctgtacgt gatggcgctg acgggtgtga cgaaacttgg ggctgtgacg       300
     ccgatcggtg gcgtcctgtt catcgcagcc tggatttttg ttgcaatcgg ggcttataaa       360
     gggctgtaa                                                               369
//

If you have problems or comments...

PBIL Back to PBIL home page