(data stored in ACNUC7421 zone)

EMBL: CP001022.PE221

CP001022.PE221       Location/Qualifiers
FT   CDS_pept        239226..241205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0223"
FT                   /product="methyl-accepting chemotaxis sensory transducer
FT                   with Cache sensor"
FT                   /note="PFAM: histidine kinase HAMP region domain protein;
FT                   Cache domain protein; chemotaxis sensory transducer; KEGG:
FT                   bsu:BSU31260 methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59709"
FT                   /db_xref="GOA:B1YHS5"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHS5"
FT                   /protein_id="ACB59709.1"
FT                   /translation="MEQKKKRTLSIKQKLILTSMLLLLIPSLLIGFVSYSQAKQKIMNE
FT                   ILQSAHAGVDRMNDEIMNIIDPMRRDVAFFADRIDGTLYQSGKQNLDLKEKMTEYLDTH
FT                   PQAANIYYATTSGEMTIYPEQSMPDDYDPRERPWYKAAEDASGKVVITDPYVDAASGKM
FT                   MVTLSQTGGNGRGVIAIDVDVDRIADIAKKIKIGKEGYVTILDSKKNFVTHPTLKPGET
FT                   ATGNWVGPLYAGKEGRFSYLFEDEDKQMDFMTNGLTGWKVAGTLYDREITDETASILWT
FT                   TLGVIAGTFLLAGLLLFFILRSIISPLNRLTKSAERIQEGDLTEEVVVESNDEIGKVAE
FT                   SFNTMILSLRGIISNLDQSIGQVAASSEELMANAAQTTAASEQIAGSIQEMAAGAGQSK
FT                   RQLDGNAVSLQAITSGVMRIAESSTNVSELSRATASEAEDGTAAVTKNVEQMKAIDSSV
FT                   ENFGEVIQSLAHRSNEIGKIVDVINGIATQTNLLALNAAIEAARAGENGKGFAVVASEV
FT                   RKLAEQSQESTKQISHLIQNIKQETERSVFLMKEVSHHTKAGLETTEDSAVRFKQIMLR
FT                   TQEMTPRIEDVTATVEEIAANVQEVSASATEIAHIADENSAASERVAATTEEQLGSMED
FT                   ISQSAKTLSDMAEELQVLVSRFKI"
     atggaacaga agaaaaaacg cacgttgagt attaaacaaa agttgatcct gacatcgatg        60
     ctcttattat tgattccttc tttattgatc ggttttgttt cttacagcca ggccaaacaa       120
     aaaatcatga atgaaatttt acagtcggct catgccggtg tcgatcggat gaatgatgaa       180
     atcatgaata tcatcgatcc gatgcgacgg gatgtcgcct tttttgcgga ccggattgac       240
     gggacgttgt atcaatcagg caaacagaat ctcgacttaa aagaaaaaat gaccgaatac       300
     ttagatacgc atccgcaagc cgctaatatt tattatgcga cgacatccgg cgagatgacg       360
     atttatccgg agcagtcgat gccggatgat tatgatccgc gtgagcgtcc atggtacaaa       420
     gcagccgaag acgccagtgg aaaagtcgtc atcacggatc catacgttga cgctgcatcg       480
     ggcaagatga tggtgacgct ctcgcaaaca ggtggaaacg gacgtggtgt catcgcaatc       540
     gacgtcgatg tcgaccggat tgccgacatc gccaagaaaa tcaaaatcgg gaaagaagga       600
     tatgtcacga ttttagattc aaagaaaaat ttcgtcactc atccgacgtt aaaaccgggt       660
     gaaacagcaa ctggcaactg ggtcggacct ctttatgccg ggaaagaagg acgcttctct       720
     tacttatttg aagatgaaga caaacagatg gacttcatga cgaacggtct gaccggctgg       780
     aaagtcgccg gtacgttgta cgaccgtgaa atcacggacg aaacagccag tattttatgg       840
     acgacattag gtgtcattgc cggtacgttt ctcctggctg gactcctgct gttctttatc       900
     ctgcgttcga tcatcagccc gctgaaccgc ttgacgaaaa gtgcggagcg gattcaggaa       960
     ggtgacttaa cggaagaagt cgtcgtcgaa tcgaacgacg aaatcggaaa agtcgcggaa      1020
     agctttaaca cgatgattct gtcactgcgc gggatcatct caaatcttga tcaatcaatc      1080
     ggtcaggtcg cggcttcttc cgaggaactg atggcgaatg ccgcacaaac gacggcagct      1140
     tcggaacaaa ttgccggctc gattcaggaa atggcggccg gagccggtca atcgaaacgc      1200
     cagctcgacg ggaatgcggt ttcgctgcaa gccatcacat cgggtgtcat gcggattgcc      1260
     gagagctcga cgaatgtgtc ggaactatca cgggcgaccg cttcagaagc agaagacgga      1320
     acggccgcgg tcacaaaaaa cgtcgaacag atgaaagcaa tcgattcatc ggtcgagaac      1380
     tttggtgagg tcatccagtc gctggcccat cgttcgaacg aaatcgggaa aattgttgat      1440
     gtcatcaacg gcattgcgac ccagacgaat ttactggcct taaatgcggc gattgaagcg      1500
     gcacgggcgg gtgagaacgg aaaagggttt gccgtcgttg ccagtgaggt gcggaagctt      1560
     gcggaacagt cgcaggaatc gacgaaacaa atctcccatc tgattcaaaa catcaaacag      1620
     gaaacggaac gttcggtctt cctgatgaaa gaagtttcgc atcatacgaa agcgggactc      1680
     gaaacgacgg aagattcagc cgttcgtttc aaacaaatca tgttgcggac gcaagaaatg      1740
     acaccgcgga tcgaagatgt cacggcaacg gtcgaagaga ttgctgccaa cgtccaggaa      1800
     gtctcggcat ccgcaacgga aatcgctcat atcgcagatg aaaattctgc agcatccgag      1860
     cgcgtcgcag cgacgacgga agaacagctt ggctcgatgg aagatatttc acaatcggct      1920
     aaaaccttgt ctgatatggc ggaagaattg caagtcctcg tatcacgatt caaaatatga      1980
//

If you have problems or comments...

PBIL Back to PBIL home page