(data stored in ACNUC7421 zone)

EMBL: CP001022.PE222

CP001022.PE222       Location/Qualifiers
FT   CDS_pept        241359..242552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0224"
FT                   /product="membrane protein-like protein"
FT                   /note="KEGG: mmr:Mmar10_1086 membrane protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59710"
FT                   /db_xref="GOA:B1YHS6"
FT                   /db_xref="InterPro:IPR018677"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHS6"
FT                   /protein_id="ACB59710.1"
FT                   /translation="MARQTKLMEWQQAGLIDAETVDRIKAYEGHRQKKKRVPLLLIVGL
FT                   TFVGLALLSFLAANWQAIPALIKIGLVLVIMVSCYVLADVSERRTIWNPVAFRILGLVA
FT                   FAGALIVTVQSFHMSMQGSFIGWAVFLAALAHFFTWRHPAYAIVAFISGLNIFTGVGGF
FT                   GTEHATFLDWTSIVLVVIVSLAWFYFSQSFPSLILSWLFLYLSGLELFALVSYDGVLWP
FT                   IWTLFVLVPLLLVVKQDSDRHFLYHLYLIVAAINSLVYLTVRAETTDSVIPLGEAVALA
FT                   VFGLAIGYLIYQKFRPLLWILPLGLFGFLWLDEQAILIAALVEIIAFVYLIVQERQGRR
FT                   LTIPFVYFIAVQLTIYFIYAWDRLDMSLFFLVGALLVFLIAGVLWWIRKRHEGGVPS"
     atggcacgac agacgaaatt aatggagtgg caacaggcgg gtttgattga tgcagagaca        60
     gtcgaccgga ttaaagcgta tgaaggtcac cgtcaaaaaa agaaacgtgt gccgttgttg       120
     ttgattgtcg gattgacctt tgtcgggtta gctttgctca gtttcttggc tgccaattgg       180
     caagcgattc ctgccctcat taaaattggt ttagtgttgg tcatcatggt cagttgttat       240
     gtgttggccg acgtatcgga acgacggacg atttggaatc cggttgcttt tcggattctt       300
     ggactggttg cctttgccgg agcgctcatc gtcaccgtcc agagttttca tatgtccatg       360
     caaggttcgt ttatcggttg ggccgtcttc ctcgccgcgc tcgcccattt ctttacgtgg       420
     cgtcatcccg cctatgcgat tgttgccttc atctcaggtt tgaatatctt taccggagtc       480
     ggcggatttg gaacggagca tgccacgttt ctcgactgga catcgattgt cctcgtcgtg       540
     atcgtatcgc ttgcctggtt ctatttcagc cagtccttcc cgtccctgat tctcagttgg       600
     ttatttcttt atctgtcggg acttgagttg tttgcccttg tctcttacga cggtgtcctt       660
     tggccgatct ggaccttatt cgtgcttgtc ccgctgttac tcgtcgttaa acaagacagc       720
     gatcgtcatt ttctatacca tctgtatctg attgtcgctg ccatcaattc actggtttat       780
     ttaacggtcc gtgccgaaac gacggactcc gtcattcctt taggagaagc cgtcgcactt       840
     gctgttttcg gtctcgcaat cggctacttg atttaccaaa aattccgtcc gttactttgg       900
     attttaccgc tcggtttgtt cggattcctt tggttggacg aacaggccat cttgattgct       960
     gcgctcgtcg aaatcattgc ctttgtttat ttgattgtgc aggagcgcca aggtcgtcgc      1020
     ctgacgattc cattcgttta cttcatcgcc gtccaactga cgatttattt catctatgcc      1080
     tgggatcgcc tcgatatgtc gttattcttc cttgtcggtg cattgctcgt cttcctgatt      1140
     gccggtgtcc tgtggtggat tcgaaaacgt catgaaggag gggttccgtc atga            1194
//

If you have problems or comments...

PBIL Back to PBIL home page