(data stored in ACNUC7421 zone)

EMBL: CP001022.PE226

CP001022.PE226       Location/Qualifiers
FT   CDS_pept        complement(246060..247826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0228"
FT                   /product="signal transduction histidine kinase, LytS"
FT                   /note="PFAM: GAF domain protein; ATP-binding region ATPase
FT                   domain protein; histidine kinase internal region; 5TM
FT                   Receptors of the LytS-YhcK type transmembrane region; KEGG:
FT                   bay:RBAM_025970 LytS"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59714"
FT                   /db_xref="GOA:B1YHT0"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR011620"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHT0"
FT                   /protein_id="ACB59714.1"
FT                   /translation="MFELIPFLLERLGIMIILAFILAQWGPTRRLLKQPEAGWQFGLLI
FT                   LIFATYGILSNYTGVKVDLAKFLPHTWLEQVDGTSAIANTRTMIVVISGLLAGPIGGTI
FT                   TGLLVGIHRYTLGGFTAFACALSTVVAGGVSGLLRPYWRDRLGSRALLPICLTGFLMVF
FT                   EMSLILLFSDPFPAALELIQFIFLPMTVVNVLGVWLFLSIIRLAAREEEHVRAREAERS
FT                   LHIADLTLPHLTRGLTIQTAEAVADILLQQTRADAVSLTDQSVILAHIGVGSDHHQSGG
FT                   HWTTRPTEHVLTDGQLRLVTDRDEIGCPKADCPLQAGIIAPLTIGETTIGTLKVYYPHP
FT                   ELLDAVEVELIEGLAKLFSTQLALGKAERQAGLLKDAEIRALEAQIHPHFLFNAINTIY
FT                   ALCRTDVEQARTLLLELSTFFRSNLQGARSTKIPLQKELEHIEAYISLEAARFPSRPFV
FT                   DIDLEDGTEQLLVPPFVLQPLIENAFQHAFSPGQTGYVGVTAWLTADQLVLEVVDNGRG
FT                   IDAERLTRLGREVVESNGTGTALFNTAERIKSLYAENGSFRLTSQPGEGTTITIHLPIE
FT                   TGKEVSHAHDPN"
     atgtttgaac tcataccctt tttactggaa cggctcggca tcatgatcat tttagcgttc        60
     atcctcgccc agtggggacc gacgcggcgt ttactgaaac agccggaagc cggctggcag       120
     tttgggttgc tgattctaat tttcgccacc tatgggattt tgagtaatta cacgggagtc       180
     aaggtcgatt tagccaagtt cttaccgcac acttggctcg aacaggttga cggtacatca       240
     gcaatcgcca acacacggac gatgattgtc gtcatcagcg gattgctcgc cggtccgatc       300
     ggtggaacga tcaccggtct cctcgttggg attcaccgct atacacttgg cgggtttacc       360
     gctttcgcct gcgccctctc gaccgtcgtc gcaggcggtg tcagtggatt actccgtccc       420
     tactggcgcg accgtctcgg cagtcgggca ttactgccga tttgcctgac gggtttttta       480
     atggttttcg aaatgtcatt gattcttctg ttttccgacc cgttcccggc cgccctcgaa       540
     ctcatccagt tcatctttct tccgatgacc gtcgtcaacg tcctcggcgt ctggctgttc       600
     ttatcgatca tccgtctcgc cgcgcgggaa gaggaacacg ttcgggcccg tgaagcggaa       660
     cggtccctgc atatcgcgga tttgacctta cctcatttga cacgcggctt aactatccaa       720
     accgcggaag ccgtggcaga tattttatta caacagacac gcgccgatgc ggtctccttg       780
     acggatcaat cagtcatttt ggcacatata ggtgtcggca gtgaccatca ccaatccggc       840
     gggcactgga cgacccgtcc gacggagcat gttttgacag acggacaact gaggcttgtc       900
     accgatcggg atgagatcgg ttgtccaaaa gcagattgcc cgttacaggc gggcatcatt       960
     gctccgttaa caatcggcga aacgacaatc gggacactca aagtgtatta tcctcatcct      1020
     gaattgctcg acgccgtcga agtcgaattg atcgaaggac tggccaagct cttctcgacc      1080
     caactcgccc tcgggaaagc cgagcggcaa gccggtctgt taaaggatgc tgaaatccgg      1140
     gccctcgaag cacagatcca tccgcatttt ttatttaatg ccatcaatac gatttacgcg      1200
     ttatgtcgga cagatgtcga acaggcacgg accttattgc tcgaactgtc gacgtttttc      1260
     cgcagcaacc tgcagggtgc ccgctcgacg aaaattccgc tccaaaaaga actggaacat      1320
     atcgaagcct atatctcact ggaagcggcc cgttttccga gccgcccgtt tgttgatatt      1380
     gatttagagg acgggacgga acaattactt gttccgcctt tcgtactcca accgttgatc      1440
     gaaaatgcct tccagcatgc gtttagtcct ggtcaaaccg gatatgtcgg cgtcacggcc      1500
     tggttaaccg cggatcaact cgttttggaa gtcgtcgata acggacgcgg gatcgacgcg      1560
     gaacgcctga cacgcctcgg tcgggaagtc gttgaatcca acggtaccgg cactgccctt      1620
     ttcaatacag ccgaacggat taaaagtctg tatgctgaaa acggttcgtt ccggctgacc      1680
     agtcaaccgg gagaaggtac gaccatcacc atccatctgc ccattgaaac aggaaaggag      1740
     gtttcccatg cgcacgatcc taattga                                          1767
//

If you have problems or comments...

PBIL Back to PBIL home page