(data stored in ACNUC7421 zone)

EMBL: CP001022.PE232

CP001022.PE232       Location/Qualifiers
FT   CDS_pept        253484..253735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0234"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59720"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHT6"
FT                   /protein_id="ACB59720.1"
FT                   /translation="MKKRSFSDTRPVSESNNPRTLESLLARHYAAQKKYARRYQEADSP
FT                   REKELAELLYEENRHAYLQAYRQLYGSNPFIEVTEDGR"
     atgaaaaaac gatctttttc agatacacgg ccggtatctg aatcaaacaa ccctcggaca        60
     ctcgaaagtt tgctcgcgcg gcattatgcg gcacaaaaaa agtatgcccg ccggtatcag       120
     gaagcagaca gtccacggga gaaagaatta gccgaattgt tatatgaaga aaatcgacat       180
     gcgtatcttc aagcctatcg gcaactgtat ggatcgaatc cgtttatcga ggtgaccgaa       240
     gatggacgtt ag                                                           252
//

If you have problems or comments...

PBIL Back to PBIL home page