(data stored in ACNUC7421 zone)

EMBL: CP001022.PE234

CP001022.PE234       Location/Qualifiers
FT   CDS_pept        254243..255763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0236"
FT                   /product="band 7 protein"
FT                   /note="PFAM: band 7 protein; KEGG: bay:RBAM_028110 YuaG"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59722"
FT                   /db_xref="GOA:B1YHT8"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR027705"
FT                   /db_xref="InterPro:IPR031905"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHT8"
FT                   /protein_id="ACB59722.1"
FT                   /translation="MNPIIIVAIIAGALILALIALFVTKYRTVGPEEALIVSGSYLGNS
FT                   PTVNTDESGNRVKIIRGGGAFILPVFQQASPLSLLSSKLEVTTPEVYTEQGVPVMADGT
FT                   AIIKIGSSISEIATAAEQFLGKSKEDREGEAREVLEGHLRSILGSMTVEEIYKNRDKFS
FT                   QEVQRVASQDLAKMGLIIVSFTIKDVRDKNGYLESLGKPRIAQVRRDADIATADAEKET
FT                   RIKRAEASKDAKKAELERATEIAEAEKENQLKMADYRREQDIAKAKADQAYDLENARAQ
FT                   QEVTEQQMQIKIIERQKQIELEEREILRREKQYDAEVKKRADADRYSIEQAAQADRAKQ
FT                   YAEADATKYRIEASAKADAERIRLDGLAKAEAERAQGETEADIIRLKGLAEAEAKEKIA
FT                   QAFEQFGQAAILDMVVRMMPEYAKQVAAPLGNIDKITVVDTGSGEGGGANRVTGYATDL
FT                   MASLQETLKASSGIDVKDLIENFSGKGTAKPLTVNLNQGEPVASGKSE"
     atgaatccga ttattattgt agcaatcata gccggtgcac tgattttagc gctgatcgcc        60
     ttattcgtca caaagtaccg cacagtcgga ccggaagaag cgttgatcgt gtccgggagt       120
     tatctcggga atagtccgac cgtcaacacg gatgaatccg gcaaccgggt caaaatcatc       180
     cgtggcggcg gagcgtttat cttacctgtc tttcagcaag catccccgct cagtctgctg       240
     tcgagcaagc tcgaagtgac gacaccggaa gtctatacag agcagggtgt tccggtcatg       300
     gcagacggga cagccatcat caaaatcggc agctcgattt cggaaatcgc gacggcagcc       360
     gaacaatttc tcgggaaatc aaaagaagac cgcgaaggcg aagcgcggga agtccttgaa       420
     gggcacttac ggtcaatcct cggttcgatg acagttgaag agatttacaa aaaccgtgat       480
     aagttttcgc aggaagtcca acgggtcgcg tcacaggatt tagcgaaaat gggactgatc       540
     atcgtatcgt ttacgatcaa agacgtccgc gataagaacg gttatttgga atcactcggg       600
     aaaccccgca ttgcccaggt ccgccgcgat gccgatatcg caacagccga tgcagaaaaa       660
     gaaacacgga ttaaacgggc agaagcctca aaagatgcga aaaaagctga actggaacgg       720
     gcgacggaaa ttgcggaagc ggaaaaagaa aatcaactga agatggccga ttaccgccgt       780
     gagcaggata tcgcgaaagc aaaagccgac caagcgtatg atcttgagaa tgcccgcgct       840
     cagcaggaag tcacggaaca acaaatgcaa atcaaaatca tcgaacgtca gaaacaaatt       900
     gaactcgaag aacgcgaaat tctccgccgt gagaaacaat acgatgcgga agtgaaaaaa       960
     cgagctgacg cggaccgtta ctccatcgag caggcggccc aggccgaccg ggcgaaacaa      1020
     tatgcggaag ccgatgccac gaaataccgg attgaagctt ctgcgaaagc cgacgctgaa      1080
     cgaattcgtc ttgatggtct ggccaaagcg gaagcagagc gggcacaagg ggaaacagaa      1140
     gccgatatca tccgtctgaa aggtcttgca gaggccgaag caaaagaaaa aatcgcgcaa      1200
     gcgttcgaac agttcggaca agcggcgatt ctcgatatgg tcgtccggat gatgccggaa      1260
     tatgcgaaac aagtcgcggc accactcggc aacatcgaca agattacagt cgttgataca      1320
     gggagcggcg agggcggcgg tgcaaaccgg gtgaccggat acgcgaccga cttgatggcc      1380
     tcgttacagg agacgcttaa agcgtcatcc ggcatcgatg tgaaagactt gattgaaaac      1440
     ttctcgggta aaggaacggc gaaaccattg acggtcaact tgaatcaagg agagccggtc      1500
     gcatcaggaa aatctgaatg a                                                1521
//

If you have problems or comments...

PBIL Back to PBIL home page