(data stored in ACNUC7421 zone)

EMBL: CP001022.PE236

CP001022.PE236       Location/Qualifiers
FT   CDS_pept        complement(256755..257576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0238"
FT                   /product="biotin/lipoate A/B protein ligase"
FT                   /note="PFAM: biotin/lipoate A/B protein ligase; KEGG:
FT                   bce:BC5386 lipoate-protein ligase A"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59724"
FT                   /db_xref="GOA:B1YHU0"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR024897"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1YHU0"
FT                   /protein_id="ACB59724.1"
FT                   /translation="MGIELLKQEHYRIFDQTSLGNTFHATQSFAMDDTLCASVATEGAA
FT                   IRSWVHHETVVLGIQDARLPHLDDGIDVLHAHGFQPVIRNSGGLAVVLDAGVLNISLVL
FT                   PERGGIDIDSGYEAMLALVRRMFAEETDAINAGEVVGSYCPGSYDLSIAGKKFAGISQR
FT                   RVRGGVAVQIYLCVNGSGSARAQLVRDFYAAALQGETTKFVYPTVVPETMASLEELLQR
FT                   PLTVEDCLVRVYRSLMELGATLTPSVLSEVENERFGVNLGRMLDRNEKVLG"
     atgggaatcg aactcttaaa acaagaacat tatcgtattt ttgatcaaac gtcactcgga        60
     aatacctttc atgccacaca atcgtttgcg atggacgata cattgtgcgc ctcagtcgct       120
     acagaaggtg ccgccatccg ttcctgggtc caccacgaaa cggttgtcct cgggattcaa       180
     gatgcacgcc tccctcacct cgatgatggg atcgacgtct tacacgccca tggtttccag       240
     ccggtcatcc gcaattccgg cgggcttgcc gttgtccttg atgccggtgt tctgaacatc       300
     tcgcttgtcc ttccggaacg tggcggaatc gatatcgaca gcggttatga agcgatgctc       360
     gcacttgtcc gtcggatgtt cgccgaagag accgatgcta tcaatgccgg cgaagtcgtc       420
     ggatcctatt gtccgggatc gtatgattta tcgattgccg gcaaaaagtt tgctgggatt       480
     tcacagcggc gtgtccgcgg tggcgtcgcc gttcaaattt atctctgcgt gaacggcagt       540
     ggcagtgccc gggcgcaact tgtccgtgat ttttatgctg ccgccctgca aggggaaacg       600
     accaagttcg tgtatccgac agtcgttccg gaaacaatgg cctctttaga agagctattg       660
     caacgtcctt tgacggtcga agactgcttg gtacgtgttt accgctcctt gatggaactt       720
     ggcgcgacac tcacgccgtc tgtcctgagc gaagtcgaaa acgaacgctt cggtgtaaac       780
     ctgggtcgga tgttggatcg aaatgaaaaa gtcctaggtt ga                          822
//

If you have problems or comments...

PBIL Back to PBIL home page