(data stored in ACNUC7421 zone)

EMBL: CP001022.PE241

CP001022.PE241       Location/Qualifiers
FT   CDS_pept        complement(261979..262164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0243"
FT                   /product="4-oxalocrotonate tautomerase family enzyme"
FT                   /note="TIGRFAM: 4-oxalocrotonate tautomerase family enzyme;
FT                   PFAM: 4-oxalocrotonate tautomerase; KEGG:
FT                   bwe:BcerKBAB4_5171 4-oxalocrotonate tautomerase family
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59729"
FT                   /db_xref="GOA:B1YHU5"
FT                   /db_xref="InterPro:IPR004370"
FT                   /db_xref="InterPro:IPR014347"
FT                   /db_xref="InterPro:IPR018191"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHU5"
FT                   /protein_id="ACB59729.1"
FT                   /translation="MPYVTVKMLAGRTVEQKRALIEKVTAAVSESVDAPKENITVFIEE
FT                   MEKTDYGQAGVMFADK"
     atgccttacg ttaccgtaaa aatgttagcc ggacgcacgg tggaacaaaa acgtgcgttg        60
     atcgaaaaag ttacagcggc cgtttctgaa tccgtcgatg cgccaaaaga aaatattacg       120
     gttttcatcg aagagatgga gaaaaccgat tacggtcaag ccggcgtcat gttcgccgac       180
     aaataa                                                                  186
//

If you have problems or comments...

PBIL Back to PBIL home page