(data stored in ACNUC7421 zone)

EMBL: CP001022.PE25

CP001022.PE25        Location/Qualifiers
FT   CDS_pept        44156..44986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0026"
FT                   /product="PSP1 domain protein"
FT                   /note="PFAM: PSP1 domain protein; KEGG: bcy:Bcer98_0027
FT                   PSP1 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59513"
FT                   /db_xref="InterPro:IPR007557"
FT                   /db_xref="UniProtKB/TrEMBL:B1YGD6"
FT                   /protein_id="ACB59513.1"
FT                   /translation="MLEVVGVRFKEAGKIYYFAPGQESLSRGQSVIVETVRGIEYGEVV
FT                   IADKQMDEEDVVLPLKSILRVADDKDAMIVRENKMAAFDAHAVCVEKIREHKLDMKLVD
FT                   VEYTFDRNKVIFYFTAEGRVDFRELVKDLAAVFRTRIELRQIGVRDEAKLLGGIGPCGR
FT                   VLCCSSFLGEFEPVSIKMAKDQNLSLNPTKISGVCGRLMCCLKYENDTYEEMRRDLPDY
FT                   GKRLTVPEGEGRVVGLNILDQIVQIELKDRSRVLTYSMEELLSVGAVKQKRPKE"
     atgctagaag tagtaggcgt tcgctttaaa gaagcgggca aaatttatta ttttgcacct        60
     ggacaagagt cattatcacg aggacaatcc gtcatcgtcg agacagtacg gggcattgaa       120
     tacggcgaag tggtgattgc cgataaacaa atggacgaag aagatgtggt cttgccattg       180
     aaatccatcc ttcgggtcgc agatgataaa gatgcgatga tcgttcgtga aaataaaatg       240
     gcagcgtttg atgcgcatgc tgtttgtgtg gaaaaaattc gtgagcacaa actcgatatg       300
     aaattagtcg atgtcgaata tacatttgat cgcaataaag tcatttttta cttcacggca       360
     gaaggtcgtg tcgatttccg ggaactcgtc aaagatttgg cggctgtttt ccggacacgc       420
     attgaattac gacaaatcgg tgtccgtgat gaagcgaagt tactgggagg aatcggtcca       480
     tgtggtcgtg ttctctgttg ctcttcgttt ttaggtgaat ttgaaccggt ctcgatcaag       540
     atggcgaaag atcaaaacct atccttgaac ccgacgaaga tttctggtgt ctgcggtcgt       600
     ttgatgtgtt gcttaaaata tgaaaatgat acgtatgaag aaatgcgacg ggatttgccg       660
     gattacggaa aacgtttgac tgttccggaa ggcgaaggac gggtagtcgg tctgaatatt       720
     cttgaccaaa tcgttcaaat tgaattaaaa gaccgttcgc gggtcctgac ttactcgatg       780
     gaggaactac tttctgtcgg tgccgtaaaa caaaaacgac caaaagaatg a                831
//

If you have problems or comments...

PBIL Back to PBIL home page