(data stored in ACNUC7421 zone)

EMBL: CP001022.PE250

CP001022.PE250       Location/Qualifiers
FT   CDS_pept        271006..271800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0252"
FT                   /product="LPXTG-motif cell wall anchor domain"
FT                   /note="KEGG: rrs:RoseRS_2469 LPXTG-motif cell wall anchor
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59738"
FT                   /db_xref="GOA:B1YHV4"
FT                   /db_xref="InterPro:IPR025510"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHV4"
FT                   /protein_id="ACB59738.1"
FT                   /translation="MKKLLSFVTAALLFALFVLPVGAADDAMVRVIHASPDAPAVDIAV
FT                   DGKKAVSGAEFKAVTDYLTLPAGEHKVEVFAAGTTKDPVLSQTLNIEAGKFYSVAAIGK
FT                   LADIKLAVMEDNGKGEDGKSMVRVAHFAPDAPAVDVAPKGGDPLFSDLEFSKVSDYGTL
FT                   DAGTYDLEVRPAGATDVVKALDGIKLDSGKNYTALAIGLLEGEPAFDVLLIPDGGEMAA
FT                   MPDTGLGGTTGTSSMATTWALVALAGAALVGTVYVVRRKQNA"
     atgaagaaac tcttatcttt cgtcacagct gctttgctat tcgcactttt tgtgctcccg        60
     gtaggcgcgg cggacgatgc aatggttcgt gtaattcatg cttcacctga tgctccagca       120
     gtggatatcg ccgtcgatgg caaaaaagcg gtatccggag cagaattcaa agcagtcact       180
     gactatctca cactcccagc cggagaacat aaagtagaag tcttcgcagc cggtacaaca       240
     aaggatcctg tactttctca aacactcaat atcgaagccg ggaaattcta ttctgtagct       300
     gcaatcggta aattggcaga tatcaaactc gccgtcatgg aagataacgg caaaggagaa       360
     gacggcaaat caatggtccg tgtcgctcac tttgcaccgg atgcaccagc tgttgacgtc       420
     gcaccaaaag gtggagatcc gctcttcagc gaccttgaat tctcgaaagt ctcagactac       480
     ggcacactcg atgccggaac gtatgacctt gaagtacgac cagccggtgc gacggatgtc       540
     gtgaaagcac tcgacggcat caagctcgac agcggtaaaa actatacagc actcgcaatc       600
     ggtttacttg aaggagaacc ggcatttgac gttctcttga ttccggacgg cggtgaaatg       660
     gcagcgatgc cggacactgg tcttggcgga acaacgggaa cgtcatcaat ggcaacaact       720
     tgggcactcg tagcacttgc tggagcagcg ctggttggga cagtttatgt cgtccgtcgt       780
     aaacaaaacg cgtaa                                                        795
//

If you have problems or comments...

PBIL Back to PBIL home page