(data stored in ACNUC7421 zone)

EMBL: CP001022.PE252

CP001022.PE252       Location/Qualifiers
FT   CDS_pept        complement(272434..273741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0254"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: chemotaxis sensory transducer; KEGG:
FT                   hmo:HM1_1276 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59740"
FT                   /db_xref="GOA:B1YHV6"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="InterPro:IPR039379"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHV6"
FT                   /protein_id="ACB59740.1"
FT                   /translation="MRNPFKAKSSMSAYQATIGFPDKRLITKTSDPSLTGRLEYMGYTE
FT                   EHLQTLKAMAPVVNSILDEVLEQVLDHLLLHPEMVQIAQTSSTRERLKKVFADYFGSLL
FT                   TGNMDDKFLAMRTRMGKTHNRNFVPVTWFIASYAAFNTLLIPKIVEHFQHEPAQLTNAI
FT                   LALNHAMNLDAQIVTSQYVDARLHEVSAANESRSRLLQDVVRVSQEVASTVEQTEGAIS
FT                   ETSRRATQILSETDQTEKTSRNLVGLTSENETQMEKMEHQFAQATSQVSTSLTSIQQLK
FT                   TTSDEIVKMTQGIEDIANQTNLLALNASIEAARAGEHGKGFSVVAIEVRNLAENAKLLS
FT                   SSINSLIQKNNGNINELVSQMEDITRSNSASRNELQQVKSGIHTVKQEMENYLEMFGRN
FT                   KNDLSQIVQTIQGISQTTQGLSALTTDLVAASEVNA"
     gtgcgcaatc catttaaagc taaatcatcg atgtcggcct atcaggcgac aatcggattt        60
     ccagacaaac gactcattac aaaaacaagt gatccgagct taaccggacg cttagaatac       120
     atgggctaca cggaagaaca tctgcaaaca ctaaaagcaa tggcgcctgt cgtcaacagc       180
     atcctcgatg aagtactcga acaagtcctt gatcatttac tgcttcaccc tgaaatggta       240
     cagattgctc aaacttcttc gacacgtgaa cgtctgaaaa aagtcttcgc tgactacttc       300
     ggcagtttac tgacgggaaa catggatgat aaatttcttg cgatgcggac acggatgggt       360
     aaaacccata accgtaactt tgtcccggtg acctggttca tcgcttccta tgcggcgttc       420
     aatacgttat tgattccgaa aatcgtcgaa cattttcaac atgaaccggc acaattgacg       480
     aatgcgattc ttgcactgaa ccacgcgatg aatcttgatg ctcaaatcgt gacgagccag       540
     tatgtcgatg cccgcttaca cgaagtcagt gcagcaaatg aatcccggag ccggctcttg       600
     caggatgtcg tacgcgtcag tcaggaagtc gcaagcactg tcgaacagac ggaaggtgca       660
     atttctgaaa caagtcgtcg ggcgacacaa atcttatctg aaacggacca gacggaaaaa       720
     acaagccgta atctggtcgg actgacctcg gaaaacgaga ctcagatgga aaagatggaa       780
     catcaatttg ctcaagccac gtcacaagtc agcacatcat tgacgagtat ccagcaactg       840
     aaaacgacgt cagatgagat cgtcaaaatg acacaaggca tcgaagacat cgctaaccag       900
     acgaacttac tcgccttgaa tgcttcgatc gaagccgctc gtgccggaga gcatgggaaa       960
     ggtttctccg tcgttgcgat tgaagtccgg aacctggcgg aaaacgcaaa actgctcagc      1020
     agcagcatca acagcctgat ccaaaaaaat aatggcaaca tcaatgaact cgtttcgcaa      1080
     atggaagaca tcacacgatc aaactccgct tcgcgtaacg aactgcaaca agtcaagagc      1140
     ggcatccata ccgtcaaaca ggaaatggag aactacttgg agatgttcgg ccgtaataaa      1200
     aatgatttaa gccaaatcgt acaaacgatt caaggtatca gccagacgac gcaagggtta      1260
     tctgccttaa cgacggattt ggtcgccgct tctgaagtga atgcttaa                   1308
//

If you have problems or comments...

PBIL Back to PBIL home page