(data stored in ACNUC7421 zone)

EMBL: CP001022.PE253

CP001022.PE253       Location/Qualifiers
FT   CDS_pept        complement(273949..274173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0255"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59741"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHV7"
FT                   /protein_id="ACB59741.1"
FT                   /translation="MVPKIEFVEHFDDNKGKRFKIELWNLGTFTFSAESAKGPVTRFTS
FT                   IDIQFVQTCVSRMRSIVDAQKAFQEDQPV"
     atggtaccga aaatcgaatt cgtagaacac ttcgatgaca acaaaggaaa acgatttaaa        60
     atcgaacttt ggaatctcgg aaccttcaca ttcagtgctg aatcagccaa aggacctgtc       120
     acccggttta cgtccatcga cattcaattc gtccagacct gtgtaagtcg gatgcgatcg       180
     atcgtcgatg cccaaaaagc gtttcaggaa gatcagcctg tttaa                       225
//

If you have problems or comments...

PBIL Back to PBIL home page