(data stored in ACNUC7421 zone)

EMBL: CP001022.PE256

CP001022.PE256       Location/Qualifiers
FT   CDS_pept        complement(275520..277652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0258"
FT                   /product="copper-translocating P-type ATPase"
FT                   /note="TIGRFAM: ATPase, P-type (transporting), HAD
FT                   superfamily, subfamily IC; copper-translocating P-type
FT                   ATPase; heavy metal translocating P-type ATPase; PFAM:
FT                   Haloacid dehalogenase domain protein hydrolase; Heavy metal
FT                   transport/detoxification protein; E1-E2 ATPase-associated
FT                   domain protein; KEGG: sae:NWMN_2457 cation-transporting
FT                   ATPase E1-E2 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59744"
FT                   /db_xref="GOA:B1YHW0"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHW0"
FT                   /protein_id="ACB59744.1"
FT                   /translation="MSKTMELNIEGMTCAACSARIEKVLNRMDGVEATVNLPLETARIA
FT                   VPEEMDEQLILDKIKKIGYGATIKTTPHEQVQNRRMLYRFWIAAFLSLPLLLSMVSHIP
FT                   NSPVHLPWLMNPWFQFALATPVQFVIGAPFYVGAYKSLRSGSANMDVLVVLGTSAAYFY
FT                   SVAEMMIHPLMPNLYFETSAVLITLVLLGKVLEDRAKQQTTGAIKSLLSLQATDAVVLE
FT                   QGVERTVSLDQVQPGMQLIVKPGQKIPVDGIITTGDAYLDESMLTGEPLPAHKGTGDVV
FT                   IGGTLNTNGYLTIEATKVGQETMLAGIIRVVEQAQTEKAPIQRQADRISGIFVPIVVAI
FT                   ALVTLAVWWWTTGSFAEAIRPAIAVLVIACPCALGLATPTSIMVGTGKGAEHGVLFKGG
FT                   AQLESLQHVDAVVFDKTGTLTIGRPVVIETFGQEQALDFAAALEKKSEHPLAHAITEER
FT                   DVVFDIEHFTVDPGRGVRGSIMGHDVMVGSVRMMQEHGLSLPDWTSSGATVVYVTVNGI
FT                   IEAGYAIRDELKPTTKQVIQEIQQTKAVYLLTGDRREVALQLATELQIPHSHVFSDVLP
FT                   IEKADHIKTLQANGQRVAMVGDGINDAPALATANVGIALGSGTDVALEAADVTLLGHDL
FT                   QQVITAIRLSEQTMKNIRQNLFFALGYNAVGIPVACLGLLAPWVAGAAMAFSSVSVVTN
FT                   ALRLKRIPLSKGGNQS"
     atgtcgaaaa caatggaact gaatatcgaa ggcatgacat gtgccgcctg ttcggcccgg        60
     atcgaaaagg tgttgaaccg gatggacgga gtcgaagcca ccgtcaacct gccgctcgaa       120
     acagcacgga ttgctgttcc ggaagaaatg gacgaacaac tgattttaga taagattaaa       180
     aaaatcggat acggtgccac catcaagacg acaccacatg aacaggtcca aaaccgccgg       240
     atgctctatc gcttttggat agcagctttc ttgtccctgc cgttactgct cagtatggtc       300
     tcccacattc cgaacagtcc ggtccatctg ccttggctga tgaatccctg gttccagttc       360
     gctttggcga cgccggtcca gttcgtcatc ggtgccccct tctatgtcgg tgcctataaa       420
     agtcttcgca gtggaagtgc caacatggat gtcctggtcg tactcggaac gtccgcagcc       480
     tatttctatt ccgttgcgga aatgatgatt cacccattga tgccgaatct ctacttcgag       540
     acgagtgccg tcctgattac gctcgtgctg ctcgggaaag tactggaaga tcgtgccaaa       600
     caacagacga ccggtgccat caaaagcctc ctttccttac aagcgacgga tgccgtcgtg       660
     ttggaacaag gtgtcgaacg gacggtttcg ctcgatcagg tccaacccgg tatgcagttg       720
     atcgtcaaac ccggtcaaaa aatcccggtc gacggcatca tcacaacggg tgatgcctat       780
     ctcgatgaat ccatgttgac cggcgaaccg cttccggctc ataaaggaac cggtgacgtc       840
     gtgattggcg gcaccttgaa cacgaacgga tacctgacga ttgaagcgac gaaagtcggt       900
     caggagacga tgcttgccgg catcatccgt gtcgtcgaac aagcgcagac ggaaaaagct       960
     cctatccagc gtcaggcgga ccggatttcc ggaatcttcg tcccaatcgt cgtcgccatc      1020
     gcccttgtga cacttgctgt ctggtggtgg acgaccggct cgttcgccga agcaattcgt      1080
     ccagccatcg ccgttcttgt catcgcctgt ccttgtgctc ttgggctcgc cactccgaca      1140
     tcgatcatgg tcggaaccgg caaaggtgcg gaacacggtg ttctgttcaa gggcggtgcc      1200
     caactcgaat cgttgcagca cgtcgatgcg gttgtctttg acaaaacagg aacattgacg      1260
     atcggacgtc cggtcgtcat cgagacgttc ggacaggaac aggcactgga ttttgcagcg      1320
     gctcttgaaa aaaaatcgga acatccactc gctcatgcaa tcacggaaga gcgcgacgtc      1380
     gtctttgata tcgaacattt caccgtcgat cccggacgcg gtgtccgcgg gtcgattatg      1440
     ggacacgatg tcatggtcgg atcggtacgg atgatgcagg agcacggtct ttcccttcct      1500
     gactggacat caagcggtgc aacggtcgtc tatgtcaccg tcaacggtat aatcgaagcc      1560
     ggatatgcca tccgcgatga attgaaaccg actaccaaac aggtcattca ggagattcag      1620
     cagacaaaag cggtctacct gctgaccgga gaccgtcgcg aagtcgcctt acaactcgcg      1680
     accgagcttc agataccaca cagccatgtg ttttccgacg ttttgccgat tgaaaaagcc      1740
     gatcacatca aaacgcttca agcaaacgga cagcgtgtcg cgatggtcgg agacgggatc      1800
     aatgatgcac cggctcttgc gacggcaaat gtcgggattg ctctcggcag cgggaccgat      1860
     gtcgcacttg aagcggcaga cgtcacgtta cttggacatg atttgcagca agtcattaca      1920
     gccatccgtc tcagcgaaca aacgatgaag aacatccggc agaacctgtt tttcgccctc      1980
     ggttataatg cagtcgggat tccggttgcc tgcctcggac tgcttgcccc ttgggtcgca      2040
     ggtgccgcga tggcattcag ctctgtctct gtcgtcacaa atgcgttacg cttaaaacgt      2100
     attccactat ccaaaggagg aaaccaatca tga                                   2133
//

If you have problems or comments...

PBIL Back to PBIL home page