(data stored in ACNUC7421 zone)

EMBL: CP001022.PE259

CP001022.PE259       Location/Qualifiers
FT   CDS_pept        complement(279887..280213)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0261"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcz:BCZK4430 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59747"
FT                   /db_xref="InterPro:IPR022551"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHW3"
FT                   /protein_id="ACB59747.1"
FT                   /translation="MTQLRKLQSISDFDQFVSEHPTFVICKHSTTCPISSAGFSAYTKY
FT                   ADETAVPTAYLLIQEARTLSNHIAEHYNVRHESPQVLYIQDGRAVWTTSHYDITSDALH
FT                   THVG"
     atgactcaac tcagaaaact acaatcgatt tccgatttcg accaattcgt ttccgaacac        60
     ccaacatttg tgatttgtaa acacagtacg acctgcccga tcagttcggc cggtttttcc       120
     gcctatacga aatatgcgga tgagacagca gttccgactg cctatttatt gattcaggaa       180
     gcacggacgt tatcgaatca catcgcagaa cattacaacg tccggcacga atcaccgcag       240
     gtcttgtaca ttcaagatgg acgagcagtc tggacgactt ctcactatga catcacatca       300
     gacgctttac acacacatgt cgggtaa                                           327
//

If you have problems or comments...

PBIL Back to PBIL home page