(data stored in ACNUC7421 zone)

EMBL: CP001022.PE260

CP001022.PE260       Location/Qualifiers
FT   CDS_pept        complement(280219..281844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0262"
FT                   /product="thiamine pyrophosphate protein domain protein
FT                   TPP-binding"
FT                   /note="PFAM: thiamine pyrophosphate protein domain protein
FT                   TPP-binding; thiamine pyrophosphate protein central region;
FT                   thiamine pyrophosphate protein TPP binding domain protein;
FT                   KEGG: amr:AM1_1865 acetolactate synthase, large subunit,
FT                   biosynthetic type"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59748"
FT                   /db_xref="GOA:B1YHW4"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHW4"
FT                   /protein_id="ACB59748.1"
FT                   /translation="MNAAERFVQCLEAEGVTHIFGVPGEENITLLEAISKSDITFITTR
FT                   HETNAAFMASMFGRLSGRPGVCLSTLGPGATNMMTGIASATMDHSPVVAITGQGATWRQ
FT                   HKASHQMFDLVEMYRPITKSSTSIVSGEVISEVVRQAFAKAVSEKPGSTHLSFPEDIAK
FT                   ADVDAKMSFLQDSPPTFLHPTSVADSDVLLRIEQAERPVVIAGFGINRSGATEAFRAFA
FT                   ERLGAPVVETMMGKGALSSLHELAAHTIGLPNADYNQRILDQSDLIIAVGYDITELPPS
FT                   KWNPERTPVLHIDTNPHEIDQFYPVVANLIGSIPDILHLLSESIPNRAWTGWQQDRDRL
FT                   RQEIQATYSLALPLHPQSIVRELEQATGEDGMIFSDVGAHKIWLGRHFQTTRPNQLFIS
FT                   NGFSSMGYGLSSAIAAKLLHPEQRVLCASGDGAFLMNGQDLETAVRLKLPIVVIIWRDG
FT                   TYGLIEWKQQQAYGRAPYIEFDNPDLVQLATAFGALGLRVGEHGTLSSCLEQAFLSDGP
FT                   VLIDCPVDYRENLKLSDRLRTYGG"
     atgaacgcgg cggaacggtt tgtccagtgt ctggaagcgg aaggcgtaac ccatatcttc        60
     ggtgtgcccg gtgaagagaa catcacgctg ctcgaagcca taagtaaatc ggatatcacg       120
     ttcatcacga cacgtcatga gacgaacgcc gccttcatgg cgtcgatgtt cggtcggtta       180
     agcggacgtc ccggtgtctg tctgtcgacg ctcggtcccg gcgcgaccaa catgatgacg       240
     gggatcgcaa gcgcgacaat ggatcactcc cctgtcgtcg ccatcaccgg acaaggtgcg       300
     acgtggcgcc agcataaagc gtcccatcaa atgtttgatt tggtcgagat gtaccggccg       360
     attaccaaat ccagcacatc gattgtttcc ggcgaagtca tttcagaagt cgttcgtcag       420
     gctttcgcaa aggctgtttc cgaaaagccc ggttcgaccc atctgtcgtt cccggaagat       480
     attgcgaagg ccgatgtcga tgccaaaatg tcctttttac aggacagtcc cccgactttt       540
     ctgcatccga catccgtggc tgatagtgat gtcctgttac gaatcgaaca ggcagaacgt       600
     ccggtcgtga ttgccggatt cggaatcaac cgcagcgggg cgacagaggc tttccgcgct       660
     ttcgccgaac gattgggggc tcccgtcgtc gagacgatga tgggaaaagg cgccttgtct       720
     tcgttacacg agctggccgc ccatacgatc ggcttgccga acgctgatta caatcaacgg       780
     attcttgatc aaagcgattt aattatcgcg gtcggctacg atatcacgga actgccacct       840
     tcgaaatgga atccggaacg gacacctgtt ttgcacattg ataccaatcc gcatgaaatt       900
     gatcaatttt atccggttgt tgcaaatttg atcggctcga tcccggatat tctgcacctg       960
     ctttcggaaa gcattccgaa tcgtgcctgg accggctggc aacaggaccg cgaccgcttg      1020
     cggcaagaaa tccaggcgac gtattccctc gctctcccgc tccatcctca aagcatcgta      1080
     cgtgaactcg agcaggcaac cggcgaggac ggcatgattt tttccgatgt cggagcgcat      1140
     aaaatatggc tcggacgaca ttttcagacg acccgtccca atcaattgtt catctctaac      1200
     gggttttctt cgatgggcta cggcttgtcg agtgcgattg ccgctaaact gttgcatccg      1260
     gaacaacgtg tcctctgcgc ttcaggagac ggtgcctttt taatgaacgg ccaggatctc      1320
     gagacggctg tccggctcaa gttgccgatc gtcgtcatca tttggcgcga cggtacctac      1380
     gggttgattg aatggaaaca acagcaagct tacggtcgtg caccttatat cgaattcgac      1440
     aatccggatc tcgttcaact ggctaccgcc tttggtgcac tgggtctgcg tgtcggggaa      1500
     cacggtactc tatccagttg tctcgaacag gcttttctga gtgacggacc cgttttaatt      1560
     gactgtccgg tcgattacag ggaaaatctg aagttaagtg accgtctacg gacttatgga      1620
     ggctga                                                                 1626
//

If you have problems or comments...

PBIL Back to PBIL home page