(data stored in ACNUC7421 zone)

EMBL: CP001022.PE262

CP001022.PE262       Location/Qualifiers
FT   CDS_pept        complement(283312..283497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0264"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59750"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHW6"
FT                   /protein_id="ACB59750.1"
FT                   /translation="MIQDILHHFTYMQKFHFFTNYYRENTLHLLNYPTLFIDQFLAFCT
FT                   TFFGKENLFFNLRVYP"
     atgattcaag acattctcca tcacttcaca tacatgcaga aatttcattt ctttacgaat        60
     tattatcgag aaaatacatt acatttactg aattatccta cactgtttat cgatcaattt       120
     ctagcctttt gcacaacctt tttcggaaaa gagaatcttt ttttcaatct tcgggtatat       180
     ccttaa                                                                  186
//

If you have problems or comments...

PBIL Back to PBIL home page