(data stored in ACNUC7421 zone)

EMBL: CP001022.PE265

CP001022.PE265       Location/Qualifiers
FT   CDS_pept        285876..286295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0267"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59753"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHW9"
FT                   /protein_id="ACB59753.1"
FT                   /translation="MAFEQTVKEMEQMLEEDWFEWLENDEPKYNEWRDQLEALAEQVMT
FT                   EYNSKVDSDAIDSLLLINEDLPVLYGEDTVMLYTALLHARKEDDSVYERYLTILGAFSE
FT                   ENHPALREVEQAVSKKDYKTAYARAVKLPQSLGLE"
     atggcgtttg aacaaaccgt aaaagaaatg gaacagatgc tcgaagaaga ttggtttgaa        60
     tggttagaga atgacgagcc gaaatacaat gaatggcgcg atcaactcga agcactggca       120
     gaacaggtca tgacggaata caattcgaaa gtcgattccg atgcgattga ttcgttatta       180
     ttgatcaacg aagatttacc ggtcttgtac ggagaagata cggtcatgct ctacacagcg       240
     ttacttcatg cacgcaagga agatgattcg gtctacgaac gttacttgac gattttaggg       300
     gcgttttcag aagaaaatca tccggcgctc cgtgaagtcg aacaggccgt gtcgaaaaaa       360
     gattacaaaa cagcatatgc acgtgccgtt aaattaccgc aatcgcttgg attagaataa       420
//

If you have problems or comments...

PBIL Back to PBIL home page