(data stored in ACNUC7421 zone)

EMBL: CP001022.PE275

CP001022.PE275       Location/Qualifiers
FT   CDS_pept        complement(296607..296954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0277"
FT                   /product="CrcB protein"
FT                   /note="TIGRFAM: CrcB protein; PFAM: Camphor resistance CrcB
FT                   protein; KEGG: btk:BT9727_4785 camphor resistance protein
FT                   CrcB"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59763"
FT                   /db_xref="GOA:B1YHX9"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHX9"
FT                   /protein_id="ACB59763.1"
FT                   /translation="MNFLALATGAFFGAISRFALSQWTKTVWKKDFPLATFIINVLGSF
FT                   LLGLVIGSHLDSTWTLLLGTGFLGSFTTFSTFKLETLQLIQNQNRKTLVLYLGLSYLCG
FT                   IGAAFLGIILA"
     atgaatttcc tcgcgcttgc gaccggtgcc ttttttgggg caatcagccg cttcgcctta        60
     agccaatgga ccaaaacggt ttggaaaaag gattttccgc tggcgacctt catcatcaat       120
     gtgctcggtt cgtttttact cggtcttgtc atcggctccc acctcgattc gacctggacg       180
     ttgttgctcg ggacaggatt tctcggctca tttacgacgt tttcgacctt taagctggaa       240
     acgttacagc tcatccagaa tcaaaatcga aagacactgg ttttgtatct cggactcagt       300
     tacctctgcg gaattggtgc cgctttttta ggaattattc ttgcctga                    348
//

If you have problems or comments...

PBIL Back to PBIL home page