(data stored in ACNUC7421 zone)

EMBL: CP001022.PE276

CP001022.PE276       Location/Qualifiers
FT   CDS_pept        complement(296951..297352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0278"
FT                   /product="CrcB protein"
FT                   /note="TIGRFAM: CrcB protein; PFAM: Camphor resistance CrcB
FT                   protein; KEGG: btk:BT9727_4784 camphor resistance protein
FT                   CrcB"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59764"
FT                   /db_xref="GOA:B1YHY0"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHY0"
FT                   /protein_id="ACB59764.1"
FT                   /translation="MLYLLVGLAGILGASARYGLGLLIGNVVVGAFPWTTLTINLIGCF
FT                   VLGYATHFLFKTTLLHQYAMTALGTGFVGSFTTFSTFSVESVELLRAGVYSYAFAYISL
FT                   SLFGGLLLSYVGYLLGTRRLRRFQKEEVS"
     atgctctatc tattagtcgg gctcgccggc atactcggcg cctctgcccg gtatggtctt        60
     ggtcttctca tcggaaatgt ggtggtgggt gcgttcccgt ggacgacgtt aaccatcaat       120
     ttaatcggtt gcttcgtatt aggttacgcg acacattttt tatttaagac gaccttactg       180
     catcagtatg caatgacggc actcggaacc ggttttgtcg gttccttcac gaccttctcg       240
     acgttcagtg tcgaatcggt tgaattgttg cgggctggtg tctatagtta tgcgttcgcc       300
     tatatcagtc tcagtttgtt tgggggctta ttgttgtctt acgttggtta tctacttgga       360
     acacgccggt tacgccgctt tcaaaaggag gaggtctcat ga                          402
//

If you have problems or comments...

PBIL Back to PBIL home page