(data stored in ACNUC7421 zone)

EMBL: CP001022.PE279

CP001022.PE279       Location/Qualifiers
FT   CDS_pept        complement(300278..301048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0281"
FT                   /product="DNA polymerase beta domain protein region"
FT                   /note="PFAM: DNA polymerase beta domain protein region;
FT                   KEGG: jan:Jann_1547 DNA polymerase, beta-like"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59767"
FT                   /db_xref="GOA:B1YHY3"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHY3"
FT                   /protein_id="ACB59767.1"
FT                   /translation="MHQLHAIEQLVARLRQDPAVEAIFLKGSFGRGEEDVYSDIDLYCL
FT                   VSEERMAKFLTRRLTHLSVYRPIIWKDDIFIVAPQLIVVYDDLLHVDLFTVTRESLNHS
FT                   DTIRVLYDPKRQLDAYVETSSLALGTQEAADEAIDSVWFLFQYQKAAGRGNGLWAVEML
FT                   RSALIKFAKVLLHRYVPDRAQLGLKTVPDYLPESPRLRLEAIYNVLVPATHIEAARLYR
FT                   EFLQEERSHLQQMLINQPDTLQLLDRLLASEQVY"
     atgcatcaac ttcatgcgat tgaacagtta gtagcacgtt tacggcaaga tccggctgtc        60
     gaagcgattt ttttgaaagg ttcatttgga cgcggtgaag aagatgtcta ttcggatatc       120
     gatctttact gtttagtatc cgaagaacgg atggcgaaat ttctaacccg tcgactgacg       180
     catctgtccg tctatcgccc gatcatctgg aaagacgata tcttcattgt cgcaccgcaa       240
     ctaattgtcg tgtacgatga tctcctgcat gtcgacctgt ttacggtgac gcgcgaatcg       300
     ttgaaccatt ccgatacgat tcgtgtcttg tatgatccga aaagacaact cgatgcgtac       360
     gtcgagactt cttctttggc actcgggaca caagaagctg cggatgaagc gattgattcc       420
     gtctggtttc tgttccagta tcaaaaagca gccggtcgcg ggaatggatt atgggcggtc       480
     gagatgttac ggagtgcact aatcaaattt gccaaagtcc tgttgcaccg gtatgttcct       540
     gaccgggcgc aactcggttt aaaaacggtt cctgactatt taccggaatc tccacgtcta       600
     cgtcttgaag cgatttataa cgtcctcgtc ccggcaacgc atatcgaagc ggcacgtctc       660
     taccgggaat tcttacagga agaacggtcg cacttgcaac agatgctgat taatcaaccg       720
     gacacgttac agttactcga ccgactgttg gcatccgaac aggtgtattg a                771
//

If you have problems or comments...

PBIL Back to PBIL home page