(data stored in ACNUC7421 zone)

EMBL: CP001022.PE28

CP001022.PE28        Location/Qualifiers
FT   CDS_pept        46125..46403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0029"
FT                   /product="Excinuclease ABC C subunit domain protein"
FT                   /note="PFAM: Excinuclease ABC C subunit domain protein;
FT                   KEGG: ssp:SSP2268 putative endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59516"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="UniProtKB/TrEMBL:B1YGD9"
FT                   /protein_id="ACB59516.1"
FT                   /translation="MSEHAVYIVRCRDGSLYTGYAIDVEKRLATHNAGQGARYTRARLP
FT                   VVLEYTETFPTKSEALKREYAIKQLTRLKKERLIQGGRSSHESNKQF"
     atgtctgagc atgccgtcta cattgtccgt tgccgggacg gcagtctcta tacaggatat        60
     gcgattgatg tcgaaaaacg gttggcgaca cacaatgccg gacaaggtgc caggtatacc       120
     cgggccagac tgccggtcgt gctcgagtat actgaaacat ttccaacgaa atcggaagcc       180
     ttaaagcgtg agtatgccat caaacaattg acacgtctaa aaaaagaacg acttattcaa       240
     ggagggaggt catctcatga aagcaacaag cagttttaa                              279
//

If you have problems or comments...

PBIL Back to PBIL home page