(data stored in ACNUC7421 zone)

EMBL: CP001022.PE284

CP001022.PE284       Location/Qualifiers
FT   CDS_pept        complement(304226..305596)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0286"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bpu:BPUM_3509 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59772"
FT                   /db_xref="GOA:B1YHY8"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHY8"
FT                   /protein_id="ACB59772.1"
FT                   /translation="MKNTKKFAATAMAAALVLPGTAAFASGGGDDMKHEESAKNVTVKT
FT                   KAADLRATLDQLLSEHFVLAVMDMKKQYDGSKDAQYYEAALKQNALDMTPAIASVYGDE
FT                   GAKQFEKIFVDHNKYTTDLVKAVKADDQDGINASKAETEGFVQDLSSFLDTATEGKLPK
FT                   AAAEEVLRAHEADVYKTFQQYAAGDYEGSYNTFREGYSRMYDISKALSVAITTQMPEKF
FT                   DNTKADTKAADLRSTLNSLAAEHVALANISMTAGVDQAKDYDAANWAEDMHTADFKAAM
FT                   KSVYGQAGADQFEQVWTKNHIEAQANLVTAAINDDKKLMGDAQDMLKMFSNDFGAFLGA
FT                   ATEENLPTKAAQEAVSGHETYVQDTFMQYVEGDYKGSADTFRESYAYMYGVGENLGEAI
FT                   VKQSPEKFMDGTPGSMPNTGNGGMSDNNTAGTTGAIALFGLALGAAGIVLARKRQNA"
     atgaaaaaca cgaaaaaatt cgcagcaaca gccatggcag cagcactcgt attaccagga        60
     acggcagcat tcgcttccgg tggcggagac gacatgaaac acgaggagag cgcgaagaac       120
     gtcacggtca aaacaaaagc cgctgacctc cgtgcaacac tcgatcagtt actctcagag       180
     cacttcgtgc ttgccgtcat ggacatgaaa aaacaatatg acggatcaaa agatgctcag       240
     tattatgaag cggcactgaa acagaacgca ctcgacatga caccggcgat cgcttctgtg       300
     tacggcgacg aaggcgcaaa acaattcgaa aaaatcttcg ttgaccacaa caaatacaca       360
     acggatctcg tcaaagccgt caaagcggac gatcaagacg gcatcaacgc gtcgaaagcg       420
     gaaacagaag ggttcgtcca ggacctttcg agcttcctcg acacagcaac agaaggtaaa       480
     ctgccgaagg cagcagcgga agaagttctc cgtgcccatg aagcggacgt ctataaaaca       540
     ttccaacaat atgcagctgg tgactacgaa ggatcgtaca acacgttccg tgaaggttac       600
     agccgcatgt atgatatctc aaaagcactc tccgtcgcga tcacaacaca gatgcctgag       660
     aagttcgaca acacgaaagc ggacacaaaa gccgctgacc tccggtcaac actcaacagc       720
     ctcgcagctg aacacgtggc acttgccaac atcagcatga cagccggcgt cgaccaagcg       780
     aaagactacg atgcagcaaa ctgggcagaa gacatgcaca cagctgactt caaagcggct       840
     atgaaatcag tctacggtca agcgggcgcg gatcaattcg agcaagtttg gacgaaaaac       900
     cacatcgaag cgcaagcaaa cctcgtcaca gcagcgatta acgatgacaa gaaattgatg       960
     ggtgacgcgc aagacatgct taaaatgttc tcaaatgact ttggtgcatt ccttggcgca      1020
     gcaacagaag aaaaccttcc gacaaaagca gcacaagaag cagtctctgg tcatgagaca      1080
     tacgtccaag atacattcat gcagtatgtc gaaggcgact acaaaggatc agctgacaca      1140
     ttccgtgagt cgtatgctta catgtacggc gtcggtgaaa acctcggtga agcgatcgtc      1200
     aaacaatcac ctgagaaatt catggacggt acaccaggtt caatgccgaa cacaggtaac      1260
     ggcggcatga gcgacaacaa tacagcaggt acgactggtg cgatcgcact cttcggtctc      1320
     gcactcggtg cagccggaat cgtcctcgca cgcaaacgtc aaaacgcata a               1371
//

If you have problems or comments...

PBIL Back to PBIL home page