(data stored in ACNUC7421 zone)

EMBL: CP001022.PE285

CP001022.PE285       Location/Qualifiers
FT   CDS_pept        306086..307465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0287"
FT                   /product="PepSY-associated TM helix domain protein"
FT                   /note="PFAM: Propeptide PepSY amd peptidase M4;
FT                   PepSY-associated TM helix domain protein; KEGG: bha:BH1854
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59773"
FT                   /db_xref="GOA:B1YHY9"
FT                   /db_xref="InterPro:IPR005625"
FT                   /db_xref="InterPro:IPR025711"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHY9"
FT                   /protein_id="ACB59773.1"
FT                   /translation="MNQLETRGTEQKTENRSASSFYRTVWRWHFYAGLIFAPFLVMLAV
FT                   TGSIYLFKPQIENVLYQKYYEVTPQENRISATAQINAVKANYPDASITKYRPGETDARS
FT                   SEVKIATAEASSTVFINPYTGKIIGELADDDRIMNKVEEIHGELMAGTIGDRIVELVAC
FT                   WAIVLIVTGLFLWFPRKKAAGWSGVLIPRLRQGKKIFRRDLHAVPAFWITAGMLFLILT
FT                   GLPWSGFWGANFQSVATNQGLGYPPSIWGGDAPVSAVQTKDVAEVPWAAETLDVPKSNV
FT                   EGLVPASIDDIVSIAKQQGMDPSFAISIPSDPAGVYTLSAYPAKAENEATIHLDQYSGA
FT                   VLADYRFANYGLVGKIVALGITLHKGTEFGLINQLISLAICLGIILVAVSGFYLWLKRK
FT                   PGKGMGAPKGPPAKSIKWFILVLIILGVLFPLVGLSLIVVWLVDFIIIRRIAVLRRFLN
FT                   A"
     atgaatcaac tcgagacgag gggaacagaa cagaaaacgg aaaaccgttc cgcatcatca        60
     ttttaccgga cggtttggcg ctggcacttt tatgccggac tgatttttgc accatttctt       120
     gtcatgcttg ccgtgacggg atcgatttac ttattcaaac cacaaatcga gaatgtgtta       180
     tatcagaagt attatgaagt gacaccgcaa gaaaaccgga tttcagcgac ggcacaaatc       240
     aatgctgtca aagcaaacta tccggacgca agtattacga agtaccgccc cggagaaacc       300
     gatgcacggt cgagtgaagt gaagattgcg acggcagagg cctcgtcgac ggtcttcatc       360
     aatccgtaca ccggaaaaat tatcggcgaa ctggcggatg atgaccggat catgaataaa       420
     gtcgaagaaa tccacggcga attgatggcc gggacaatcg gagaccggat cgttgaactt       480
     gttgcctgtt gggcgattgt cttaatcgta acaggattat ttttatggtt cccgcgtaaa       540
     aaagcagccg gttggagtgg tgtcttgatt ccgcgtctgc gccaggggaa aaaaatcttc       600
     cgacgtgatt tgcacgcggt gccggccttt tggattacgg ccgggatgtt attcctgatt       660
     ttgacgggat tgccgtggtc cggtttttgg ggcgccaatt tccaatcagt tgcaaccaat       720
     caaggacttg gttatccacc atcgatttgg ggaggagatg cgccggtatc agccgttcaa       780
     acgaaagatg tggcagaagt cccgtgggca gcggagacgc ttgacgtgcc gaaatcaaac       840
     gtcgaaggac ttgttccggc atcaatcgat gacattgtat caatcgccaa acaacagggg       900
     atggatccaa gcttcgcgat cagcattccg agtgatccgg caggtgtcta cacactgtcg       960
     gcctacccgg cgaaagcgga aaatgaagcg acgattcatc tcgatcaata ttctggtgct      1020
     gttttagcgg attaccggtt tgctaactat gggcttgtcg gtaaaatcgt tgcactcggt      1080
     atcacgctgc acaaaggaac tgaattcggt ctgatcaatc aattgatcag tttagccatt      1140
     tgtcttggaa tcatcttggt agcggtcagt ggattctatc tatggttgaa acggaaaccg      1200
     ggcaaaggga tgggggcacc gaaaggaccg ccggcgaaat ccatcaaatg gtttattctc      1260
     gtgctgatta tcctcggtgt cctgttcccg ctggttggtc tgtcgttaat tgtggtctgg      1320
     ctggtggatt tcatcatcat ccggcgaatt gcggttctaa ggaggttttt gaatgcgtaa      1380
//

If you have problems or comments...

PBIL Back to PBIL home page