(data stored in ACNUC7421 zone)

EMBL: CP001022.PE286

CP001022.PE286       Location/Qualifiers
FT   CDS_pept        307458..307943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0288"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bha:BH1853 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59774"
FT                   /db_xref="InterPro:IPR032693"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHZ0"
FT                   /protein_id="ACB59774.1"
FT                   /translation="MRKSIQGLLVSGLIVTSTGLAGCSVTSDAAEHYAVSAPLSVKFEI
FT                   PKVLKADQEKQYRFGATLWQDQKAVKEAEYVHFEIWKADGTLRYSMEPADETKPGVYSI
FT                   EKKLPKEGLYYIKVHASSNGAMIMPTRQFIVGELSANDLKILQGGAKPAGGSSGHHH"
     atgcgtaagt ccatccaagg tcttttagta agtggactga ttgtcaccag taccggtctt        60
     gcaggatgta gtgttacgtc tgacgcggca gaacattacg cagtctcagc accgctgtct       120
     gtaaagtttg aaattccgaa agtactgaaa gctgatcagg aaaaacagta ccgattcgga       180
     gcaacactgt ggcaggatca aaaagcagtt aaagaagcgg aatatgtcca ttttgaaatc       240
     tggaaagcag atggaacact tcggtacagt atggaaccgg cagatgaaac gaaaccggga       300
     gtttactcga ttgagaagaa attgccgaag gaaggtctgt attacatcaa agttcacgcc       360
     agcagtaacg gggcgatgat tatgccgacc agacagttta ttgtcggcga actgtccgcc       420
     aacgacttaa aaatcttgca aggcggtgcg aaaccggctg gtggaagcag cgggcatcat       480
     cattaa                                                                  486
//

If you have problems or comments...

PBIL Back to PBIL home page