(data stored in ACNUC7421 zone)

EMBL: CP001022.PE290

CP001022.PE290       Location/Qualifiers
FT   CDS_pept        311231..312286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0292"
FT                   /product="methylated-DNA--protein-cysteine
FT                   methyltransferase"
FT                   /note="KEGG: cbd:COXBU7E912_0849 metal binding domain of
FT                   Ada/methylated-DNA-[protein]-cysteine S-methyltransferase;
FT                   TIGRFAM: methylated-DNA--protein-cysteine
FT                   methyltransferase; PFAM: Ada metal-binding domain protein;
FT                   methylguanine DNA methyltransferase ribonuclease domain
FT                   protein; Methylated-DNA-[protein]-cysteine
FT                   S-methyltransferase DNA binding; SMART: helix-turn-helix-
FT                   domain containing protein AraC type"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59778"
FT                   /db_xref="GOA:B1YHZ4"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR004026"
FT                   /db_xref="InterPro:IPR008332"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR016221"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR023546"
FT                   /db_xref="InterPro:IPR035451"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHZ4"
FT                   /protein_id="ACB59778.1"
FT                   /translation="MMNTLPETDYYEALVRRDGSYEGTFFVGVKTTGIFCRPTCPARKP
FT                   KQENCEFFETAKEALLASYRPCLRCKPLAYPGDSEVITRLIAAVEANPEKRFKDADFRE
FT                   LGLDASTARRQFKKRFGMTFVEYARSRRMGLAMKEIRKGQPVIEVQLASGYESSSGFRD
FT                   AFARILGETPKRWSGAYLQAKWLDTPLGPMLAIADEGGLHLLEFVDRRGLEREVERLRL
FT                   TARAVIIPGDAPVFEQVTVQLEEYFAGTRDRFDLPLVLYGTPFQRQVWEQLCLIPAGET
FT                   ISYQELAVRVGNPAAVRAVARANGANQLAILIPCHRVIRLAGDLGGYAGGLARKAALLK
FT                   LERTKRGLNHR"
     atgatgaata ccttaccgga aacggattat tatgaagcgc tcgtccgtcg tgatggttcg        60
     tacgagggga cattttttgt cggggtcaag acgacgggga ttttttgccg gccgacctgt       120
     ccggcacgga aaccgaagca ggagaattgt gagttttttg agacggcgaa agaggcgtta       180
     ctggcttcgt accggccgtg tttacgctgt aaaccgctcg cttacccggg ggacagtgag       240
     gtcatcaccc gcttgattgc agcggtcgaa gcaaatcccg aaaaacgctt caaagacgcc       300
     gactttcgtg aactgggact cgatgcctcg accgcacgac ggcagttcaa aaaaagattc       360
     gggatgacgt tcgtcgaata tgctcggtca cgccggatgg gactggcgat gaaggaaatc       420
     cggaaggggc aaccggtcat cgaggtccaa ctggcaagcg gttatgaatc gagcagcggt       480
     ttccgcgatg cctttgcccg cattttgggc gagacaccga aacgttggag tggagcctat       540
     ctgcaggcga agtggctcga tacgccgctc ggaccgatgc tggcgattgc cgatgaagga       600
     ggactgcact tactcgagtt cgtcgatcga cgcggactgg aacgggaagt ggaacggttg       660
     cggctgacag cccgggctgt gatcattccc ggtgacgccc cggtgtttga acaggtgacg       720
     gttcaactgg aagaatactt tgccggaacg cgcgaccgat ttgatcttcc gctcgttctc       780
     tacgggacgc cgtttcaacg gcaggtctgg gagcaattgt gtttaattcc ggcgggcgag       840
     acaatttcgt atcaggaact ggccgtccgt gtcggaaatc cggcagccgt ccgcgccgtc       900
     gcccgggcga acggtgccaa tcaactggcg attctgattc cctgtcaccg ggtcatccgg       960
     ctggccggag atcttggcgg ttacgccggc ggcttggcgc gaaaagctgc gttactcaaa      1020
     ctagaacgga cgaagagagg attgaatcat agatga                                1056
//

If you have problems or comments...

PBIL Back to PBIL home page