(data stored in ACNUC7421 zone)

EMBL: CP001022.PE292

CP001022.PE292       Location/Qualifiers
FT   CDS_pept        313335..313661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0294"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59780"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHZ6"
FT                   /protein_id="ACB59780.1"
FT                   /translation="MKGRHPDFTTSRLSITATDTANGCIWVLKKRENEQVALIQLTGQQ
FT                   LSSDAIDPSDRDGYIQEALTVILSYLARTLLLPFVTGEGGEAEIWLENGFYKDGPVFRR
FT                   DLTH"
     atgaaaggtc gccatccgga ctttacgaca tcccggttat cgattacagc tacggatact        60
     gccaacggat gtatctgggt actgaagaaa agagagaacg aacaggtcgc tctgattcaa       120
     ttaaccggtc agcagctcag ctctgacgca attgatccgt ccgaccgtga cggctatatc       180
     caagaagcct tgaccgtcat cctttcgtat ctcgcgcgga cgttgctgtt gccattcgtg       240
     acaggagagg gcggagaagc agagatttgg cttgaaaatg gattttataa ggacggtccg       300
     gtttttcgtc gtgacttgac gcattga                                           327
//

If you have problems or comments...

PBIL Back to PBIL home page