(data stored in ACNUC7421 zone)

EMBL: CP001022.PE293

CP001022.PE293       Location/Qualifiers
FT   CDS_pept        complement(313900..314196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0295"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59781"
FT                   /db_xref="GOA:B1YHZ7"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHZ7"
FT                   /protein_id="ACB59781.1"
FT                   /translation="MNQSKQTYLPVFLTLGLLLFNMLTSYLLSGQFFPNLSLWVPIGLN
FT                   VLVGLGYIVSLVMGLRSTNNYVKWFSMLANTAFLLSLSVITFMLLLANGISEP"
     atgaatcaat ccaagcagac atacttgccg gttttcttga cgcttggttt gcttctgttc        60
     aatatgctga cgtcctactt actgagcgga caattttttc cgaacctgag cctgtgggtg       120
     ccgatcggtc tcaacgtgtt ggtcggactc ggctatatcg tttcgctggt aatgggtctc       180
     cggtcgacaa ataactacgt caaatggttc agtatgttgg cgaacaccgc ctttttgctg       240
     tcactatcgg tcatcacctt tatgttatta ctcgcaaacg gcatttcaga gccttaa          297
//

If you have problems or comments...

PBIL Back to PBIL home page